Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT3JCE6)

DTP Name Sulfonylurea receptor 2 (ABCC9)
Gene Name ABCC9
UniProt ID
O60706 (ABCC9_HUMAN)
VARIDT ID
DTD0062
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ATP-binding cassette sub-family C member 9; ABCC9; SUR2; ABC37; CANTU; CMD1O; ATFB12
DTP Family ATP-Binding Cassette (ABC) Superfamily
Drug Conjugate Transporter (DCT) Family (ABCC)
Sequence
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHH
NTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIV
YYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLL
MAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHK
KPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLS
STFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFL
ALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIE
TNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEA
QKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSI
FMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAII
SVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTR
RLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILG
EMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQR
YKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFS
ALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQ
TKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEE
EDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTS
EYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGP
IRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALL
PLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLE
LTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITN
YLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVR
YENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKL
PLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDA
VVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTV
VTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK
Function This transporter is subunit of ATP-sensitive potassium channels (KATP).
Endogenous Substrate(s) Sulfonylurea
TCDB ID
3.A.1.208.23
Gene ID
10060
KEGG Pathway
ABC transporters (hsa02010 )
Reactome Pathway
ABC-family proteins mediated transport (R-HSA-382556 )
Ion homeostasis (R-HSA-5578775 )
Defective ABCC9 causes CMD10, ATFB12 and Cantu syndrome (R-HSA-5678420 )
ATP sensitive Potassium channels (R-HSA-1296025 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tolbutamide DM02AWV Advanced cancer 2A00-2F9Z Approved [9]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.21E-01 -6.06E-03 -5.97E-02
Adrenocortical carcinoma 2D11.Z Kidney 3.86E-02 -1.78E-01 -6.12E-01
Alopecia ED70 Skin from scalp 3.09E-04 3.76E-01 1.19E+00
Alzheimer's disease 8A20 Entorhinal cortex 3.06E-04 3.14E-01 7.90E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.38E-01 5.68E-02 4.16E-01
Aortic stenosis BB70 Calcified aortic valve 8.83E-01 1.04E-01 1.58E-01
Apnea 7A40 Hyperplastic tonsil 1.38E-01 1.03E-01 4.69E-01
Arthropathy FA00-FA5Z Peripheral blood 7.31E-01 2.34E-02 2.06E-01
Asthma CA23 Nasal and bronchial airway 3.97E-05 -7.98E-02 -1.79E-01
Atopic dermatitis EA80 Skin 1.81E-07 -6.16E-01 -2.13E+00
Autism 6A02 Whole blood 1.42E-01 -8.73E-03 -5.46E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.79E-01 -3.09E-02 -4.76E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.85E-01 -2.07E-02 -1.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.47E-04 8.39E-02 5.96E-01
Batten disease 5C56.1 Whole blood 4.68E-01 1.25E-01 9.40E-01
Behcet's disease 4A62 Peripheral blood 2.77E-01 1.05E-01 5.95E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.91E-02 4.29E-02 2.84E-01
Bladder cancer 2C94 Bladder tissue 2.99E-01 1.21E-01 3.82E-01
Breast cancer 2C60-2C6Z Breast tissue 3.50E-55 -6.13E-01 -1.24E+00
Cardioembolic stroke 8B11.20 Whole blood 9.20E-02 5.24E-02 5.46E-01
Cervical cancer 2C77 Cervical tissue 7.70E-05 -1.71E-01 -9.50E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.27E-01 -2.61E-03 -2.27E-02
Chronic hepatitis C 1E51.1 Whole blood 3.91E-01 1.54E-01 8.04E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.51E-01 2.26E-02 6.23E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.46E-01 2.42E-02 2.17E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.80E-01 2.23E-01 8.98E-01
Colon cancer 2B90 Colon tissue 1.23E-13 1.10E-01 6.69E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.57E-01 -1.91E-03 -2.86E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.11E-01 -3.34E-01 -1.22E+00
Endometriosis GA10 Endometrium tissue 7.81E-03 9.93E-02 2.93E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.38E-01 5.16E-02 4.70E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.59E-05 -3.02E-01 -1.87E+00
Gastric cancer 2B72 Gastric tissue 7.06E-01 -5.17E-02 -7.37E-02
Glioblastopma 2A00.00 Nervous tissue 1.76E-06 -8.42E-03 -2.60E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.00E-03 -3.04E-01 -1.76E+00
Head and neck cancer 2D42 Head and neck tissue 8.46E-01 1.73E-02 9.14E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.08E-01 1.61E-01 4.88E-01
Huntington's disease 8A01.10 Whole blood 9.33E-01 1.75E-02 2.20E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.65E-01 -1.51E-01 -2.76E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.85E-01 -8.68E-02 -9.68E-01
Influenza 1.00E+30 Whole blood 1.82E-01 1.37E-01 7.27E-01
Interstitial cystitis GC00.3 Bladder tissue 6.00E-01 -7.26E-02 -3.45E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.01E-06 -7.91E-01 -1.82E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.95E-01 1.74E-01 3.98E-01
Ischemic stroke 8B11 Peripheral blood 8.79E-01 -2.97E-02 -1.65E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.99E-01 2.30E-02 6.67E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 9.06E-01 3.39E-02 2.58E-01
Lateral sclerosis 8B60.4 Skin 9.52E-02 -3.39E-01 -1.75E+00
Liver cancer 2C12.0 Liver tissue 1.81E-07 -9.42E-01 -1.33E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.98E-05 -2.05E+00 -3.54E+00
Lung cancer 2C25 Lung tissue 1.36E-26 -3.87E-01 -1.12E+00
Lupus erythematosus 4A40 Whole blood 9.98E-02 4.41E-02 1.50E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.51E-01 6.05E-02 1.99E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.14E-01 -1.46E-02 -9.24E-02
Melanoma 2C30 Skin 6.37E-01 -2.19E-02 -6.00E-02
Multiple myeloma 2A83.1 Bone marrow 1.26E-03 -4.71E-01 -1.68E+00
Multiple myeloma 2A83.1 Peripheral blood 1.60E-01 -6.60E-02 -4.75E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.87E-01 1.84E-02 7.19E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.04E-02 5.88E-02 4.98E-01
Myelofibrosis 2A20.2 Whole blood 2.08E-01 4.22E-02 3.30E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.27E-02 1.44E-01 3.30E-01
Myopathy 8C70.6 Muscle tissue 6.39E-01 -7.90E-02 -1.25E-01
Neonatal sepsis KA60 Whole blood 5.17E-03 2.53E-02 1.81E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.29E-01 -2.39E-01 -6.28E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.16E-01 -5.93E-02 -2.93E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.31E-01 -3.92E-01 -1.25E+00
Olive pollen allergy CA08.00 Peripheral blood 3.30E-01 2.22E-01 1.43E+00
Oral cancer 2B6E Oral tissue 5.92E-02 -1.13E-01 -2.45E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.56E-01 -2.14E-01 -2.86E-01
Osteoporosis FB83.1 Bone marrow 4.54E-01 2.43E-01 1.17E+00
Ovarian cancer 2C73 Ovarian tissue 3.54E-03 -4.77E-01 -1.41E+00
Pancreatic cancer 2C10 Pancreas 1.17E-01 -1.66E-01 -5.33E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.00E-01 8.27E-02 4.10E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.46E-01 -7.48E-02 -5.57E-01
Pituitary cancer 2D12 Pituitary tissue 2.71E-01 -5.95E-02 -2.35E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.23E-01 -1.28E-01 -4.64E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.85E-01 1.30E-01 5.73E-01
Polycythemia vera 2A20.4 Whole blood 3.52E-07 1.63E-01 1.44E+00
Pompe disease 5C51.3 Biceps muscle 5.15E-02 -5.62E-01 -1.53E+00
Preterm birth KA21.4Z Myometrium 3.44E-01 -8.24E-02 -2.20E-01
Prostate cancer 2C82 Prostate 2.19E-01 -1.52E-01 -2.21E-01
Psoriasis EA90 Skin 1.99E-05 -2.28E-01 -6.18E-01
Rectal cancer 2B92 Rectal colon tissue 9.37E-02 1.27E-01 8.09E-01
Renal cancer 2C90-2C91 Kidney 2.25E-01 1.89E-02 6.38E-02
Retinoblastoma 2D02.2 Uvea 3.97E-01 3.04E-02 3.22E-01
Rheumatoid arthritis FA20 Synovial tissue 2.96E-01 -1.97E-01 -3.80E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.71E-01 -8.13E-04 -7.98E-03
Schizophrenia 6A20 Prefrontal cortex 8.54E-01 -4.98E-02 -2.60E-01
Schizophrenia 6A20 Superior temporal cortex 8.21E-01 5.89E-03 4.19E-02
Scleroderma 4A42.Z Whole blood 5.17E-07 1.49E-01 2.08E+00
Seizure 8A60-8A6Z Whole blood 2.80E-01 -4.78E-02 -2.81E-01
Sensitive skin EK0Z Skin 4.20E-01 -1.49E-01 -5.57E-01
Sepsis with septic shock 1G41 Whole blood 1.15E-07 2.44E-02 1.58E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.66E-01 7.60E-02 5.46E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.96E-01 4.72E-02 4.14E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.27E-02 -1.01E-01 -1.22E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.87E-01 -8.10E-02 -1.33E+00
Skin cancer 2C30-2C3Z Skin 5.87E-36 -4.75E-01 -1.22E+00
Thrombocythemia 3B63 Whole blood 3.52E-01 4.50E-02 3.40E-01
Thrombocytopenia 3B64 Whole blood 3.83E-01 8.03E-02 9.63E-01
Thyroid cancer 2D10 Thyroid 7.59E-04 -9.44E-04 -5.37E-03
Tibial muscular dystrophy 8C75 Muscle tissue 5.28E-01 3.23E-01 6.79E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.59E-02 4.34E-01 1.25E+01
Type 2 diabetes 5A11 Liver tissue 9.34E-01 1.01E-01 1.95E-01
Ureter cancer 2C92 Urothelium 5.97E-01 3.21E-02 2.60E-01
Uterine cancer 2C78 Endometrium tissue 1.69E-02 -1.13E-01 -3.19E-01
Vitiligo ED63.0 Skin 8.93E-01 6.29E-02 1.29E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name ATP-binding cassette transporter C9 (ABCC9) DTT Info
DTP DTT Type Successful
4 Approved Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glimepiride DM5FSJA Diabetic complication 5A2Y Approved [1]
Nicorandil DMIYJFV Angina pectoris BA40 Approved [2]
Repaglinide DM5SXUV Diabetic complication 5A2Y Approved [3]
Tolbutamide DM02AWV Advanced cancer 2A00-2F9Z Approved [4]
------------------------------------------------------------------------------------
4 Discontinued Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
BTS-67582 DM54K2P Diabetic complication 5A2Y Discontinued in Phase 2 [5]
KRN-2391 DMZ1SEW Angina pectoris BA40 Discontinued in Phase 2 [6]
BMS-191095 DMKFXTD Angina pectoris BA40 Discontinued in Phase 1 [7]
CCX915 DMHMST3 Multiple sclerosis 8A40 Discontinued in Phase 1 [8]
------------------------------------------------------------------------------------

References

1 Mechanism of disopyramide-induced hypoglycaemia in a patient with Type 2 diabetes. Diabet Med. 2009 Jan;26(1):76-8.
2 A functional role of the C-terminal 42 amino acids of SUR2A and SUR2B in the physiology and pharmacology of cardiovascular ATP-sensitive K(+) chann... J Mol Cell Cardiol. 2005 Jul;39(1):1-6.
3 Metformin/Repaglinide (PrandiMet) for type 2 diabetes. Med Lett Drugs Ther. 2009 Jun 1;51(1313):41-3.
4 Expression of an activating mutation in the gene encoding the KATP channel subunit Kir6.2 in mouse pancreatic beta cells recapitulates neonatal diabetes. J Clin Invest. 2009 Jan;119(1):80-90.
5 BTS-67582 (Knoll Pharmaceuticals Co). IDrugs. 1999 Apr;2(4):355-9.
6 Effects of KRN2391 on ionic currents in rabbit femoral arterial myocytes
7 The mitochondrial K(ATP) channel opener BMS-191095 reduces neuronal damage after transient focal cerebral ischemia in rats.J Cereb Blood Flow Metab.2007 Feb;27(2):348-55.
8 Analysis of the differential modulation of sulphonylurea block of beta-cell and cardiac ATP-sensitive K+ (K(ATP)) channels by Mg-nucleotides. J Physiol. 2003 Feb 15;547(Pt 1):159-68.
9 ABCC8 and ABCC9: ABC transporters that regulate K+ channels. Pflugers Arch. 2007 Feb;453(5):703-18.