Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT5G94L)

DTP Name Major facilitator superfamily domain-containing protein 2A (SLC59A1)
Gene Name SLC59A1
UniProt ID
Q8NA29 (NLS1_HUMAN)
VARIDT ID
DTD0416
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms 3-PGDH; 3PGDH; HEL-S-113; MFSD2; MFSD2A; NLS; NLS1; PDG; PGAD; PGD; PGDH; PHGDHD; SERA; Sodium-dependent LPC symporter 1; Sodium-dependent lysophosphatidylcholine symporter 1
DTP Family Glycoside-Pentoside-Hexuronide (GPH):Cation Symporter Family ;
Sequence
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTG
CALGFFLQIYLLDVAQKDEEVVFCFSSFQVGPFSASIILFVGRAWDAITDPLVGLCISKS
PWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYCLFETMVTCFHVPYSA
LTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSSTVASQSAN
HTHGTTSHRETQKAYLLAAGVIVCIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRL
VMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIW
QWFLTRFGKKTAVYVGISSAVPFLILVALMESNLIITYAVAVAAGISVAAAFLLPWSMLP
DVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVK
FTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELA
SIL
Function
This sodium-dependent lysophosphatidylcholine (LPC) transporter plays an essential role for blood-brain barrier formation and function. Transports LPC carrying long-chain fatty acids such LPC oleate and LPC palmitate with a minimum acyl chain length of 14 carbons. Not required for central nervous system vascular morphogenesis. Acts as a transporter for tunicamycin, an inhibitor of asparagine-linked glycosylation. In placenta, acts as a receptor for ERVFRD-1/syncytin-2 and is required for trophoblast fusion.
Endogenous Substrate(s) Tunicamycin
TCDB ID
2.A.2.3.8
Gene ID
26227
Reactome Pathway
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Hypertriglyceridemia 5C80.1 Approved [1]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
lysophosphatidylcholine DMOGFVH Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.31E-15 4.59E-01 9.54E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.59E-03 -1.16E-01 -4.87E-01
Alopecia ED70 Skin from scalp 6.04E-02 -2.61E-01 -6.58E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.02E-08 4.21E-01 6.54E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.60E-01 -1.27E-01 -4.49E-01
Aortic stenosis BB70 Calcified aortic valve 7.61E-01 -1.10E-01 -1.09E-01
Apnea 7A40 Hyperplastic tonsil 3.82E-02 -1.35E+00 -1.37E+00
Arthropathy FA00-FA5Z Peripheral blood 3.25E-01 1.29E-01 6.38E-01
Asthma CA23 Nasal and bronchial airway 3.88E-01 -1.38E-02 -1.87E-02
Atopic dermatitis EA80 Skin 4.57E-02 2.02E-01 8.71E-01
Autism 6A02 Whole blood 3.83E-03 -1.77E-01 -7.01E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.45E-02 -1.15E-01 -6.52E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.88E-02 -1.01E-01 -1.30E+00
Bacterial infection of gingival 1C1H Gingival tissue 6.90E-05 -2.30E-01 -6.32E-01
Batten disease 5C56.1 Whole blood 7.27E-01 1.49E-01 5.61E-01
Behcet's disease 4A62 Peripheral blood 7.32E-01 -4.58E-02 -1.74E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.36E-01 5.34E-02 1.35E-01
Bladder cancer 2C94 Bladder tissue 7.06E-02 -2.74E-01 -7.88E-01
Breast cancer 2C60-2C6Z Breast tissue 4.00E-37 -7.66E-01 -1.13E+00
Cardioembolic stroke 8B11.20 Whole blood 2.92E-01 5.48E-02 1.44E-01
Cervical cancer 2C77 Cervical tissue 2.02E-03 -5.43E-01 -6.72E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.88E-02 4.51E-02 2.62E-01
Chronic hepatitis C 1E51.1 Whole blood 4.78E-01 1.18E-01 3.98E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.36E-01 -3.70E-02 -1.18E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.32E-01 -1.81E-02 -5.07E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.29E-01 -4.06E-01 -1.21E+00
Colon cancer 2B90 Colon tissue 3.85E-126 1.21E+00 3.58E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.79E-02 3.97E-01 1.85E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.51E-01 -2.09E-01 -3.89E-01
Endometriosis GA10 Endometrium tissue 1.53E-02 -5.16E-01 -5.99E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.76E-01 -3.11E-02 -1.32E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.80E-02 -2.33E-01 -9.17E-01
Gastric cancer 2B72 Gastric tissue 2.11E-01 -2.96E-01 -7.66E-01
Glioblastopma 2A00.00 Nervous tissue 6.84E-02 1.07E-01 1.65E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.72E-03 1.20E+00 1.80E+00
Head and neck cancer 2D42 Head and neck tissue 1.13E-03 -3.01E-01 -5.39E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.09E-01 1.56E-01 2.60E-01
Huntington's disease 8A01.10 Whole blood 9.72E-01 4.17E-02 1.81E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.95E-02 -6.87E-01 -1.01E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.81E-02 3.03E-01 1.68E+00
Influenza 1.00E+30 Whole blood 2.93E-02 1.64E-01 1.58E+00
Interstitial cystitis GC00.3 Bladder tissue 1.72E-04 -1.10E+00 -3.75E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.80E-13 -2.29E+00 -6.78E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.54E-01 -1.44E-01 -2.91E-01
Ischemic stroke 8B11 Peripheral blood 5.09E-01 1.20E-01 6.06E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.68E-02 -2.48E-01 -5.81E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.93E-01 1.18E-01 1.43E-01
Lateral sclerosis 8B60.4 Skin 6.83E-01 -9.88E-02 -2.80E-01
Liver cancer 2C12.0 Liver tissue 1.07E-21 -1.67E+00 -2.62E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.99E-01 -4.12E-01 -6.67E-01
Lung cancer 2C25 Lung tissue 9.28E-26 4.14E-01 1.01E+00
Lupus erythematosus 4A40 Whole blood 8.09E-02 -3.38E-02 -7.81E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.52E-01 1.30E-03 3.54E-03
Major depressive disorder 6A70-6A7Z Hippocampus 2.50E-01 -1.89E-01 -5.09E-01
Melanoma 2C30 Skin 1.05E-02 -3.73E-01 -4.61E-01
Multiple myeloma 2A83.1 Bone marrow 2.77E-05 1.23E+00 3.11E+00
Multiple myeloma 2A83.1 Peripheral blood 5.59E-01 -4.02E-01 -3.24E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.97E-01 5.01E-02 1.70E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.04E-09 -2.57E-01 -7.50E-01
Myelofibrosis 2A20.2 Whole blood 2.19E-03 -2.45E-01 -1.80E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.90E-01 3.92E-04 7.33E-04
Myopathy 8C70.6 Muscle tissue 7.65E-02 1.83E-01 7.08E-01
Neonatal sepsis KA60 Whole blood 7.66E-01 -3.47E-02 -1.29E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.66E-04 -4.92E-01 -1.17E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.16E-01 -2.23E-01 -1.87E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.61E-02 4.33E-01 1.76E+00
Olive pollen allergy CA08.00 Peripheral blood 7.93E-01 1.27E-01 3.16E-01
Oral cancer 2B6E Oral tissue 2.62E-04 -4.95E-01 -6.56E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.76E-01 -2.91E-02 -1.95E-02
Osteoporosis FB83.1 Bone marrow 2.55E-01 6.36E-01 1.23E+00
Ovarian cancer 2C73 Ovarian tissue 9.55E-02 6.56E-01 1.19E+00
Pancreatic cancer 2C10 Pancreas 1.38E-02 -9.41E-01 -1.14E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.68E-02 2.29E-01 7.54E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.01E-03 1.77E-01 1.15E+00
Pituitary cancer 2D12 Pituitary tissue 2.25E-02 -5.21E-01 -1.16E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.74E-02 -9.43E-01 -1.96E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.00E-01 5.35E-02 2.87E-01
Polycythemia vera 2A20.4 Whole blood 1.14E-01 -9.46E-02 -5.59E-01
Pompe disease 5C51.3 Biceps muscle 5.74E-01 6.16E-02 2.60E-01
Preterm birth KA21.4Z Myometrium 3.06E-01 -5.73E-01 -8.62E-01
Prostate cancer 2C82 Prostate 2.03E-02 -6.33E-01 -7.79E-01
Psoriasis EA90 Skin 9.53E-06 2.17E-01 5.91E-01
Rectal cancer 2B92 Rectal colon tissue 1.41E-05 6.95E-01 3.46E+00
Renal cancer 2C90-2C91 Kidney 1.28E-03 -8.61E-01 -1.29E+00
Retinoblastoma 2D02.2 Uvea 2.05E-01 3.94E-01 3.06E+00
Rheumatoid arthritis FA20 Synovial tissue 1.59E-04 1.81E-01 7.31E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.66E-01 -2.64E-03 -1.03E-02
Schizophrenia 6A20 Prefrontal cortex 3.05E-01 -6.37E-02 -7.41E-02
Schizophrenia 6A20 Superior temporal cortex 5.67E-01 3.23E-02 9.28E-02
Scleroderma 4A42.Z Whole blood 6.31E-01 -4.71E-02 -2.26E-01
Seizure 8A60-8A6Z Whole blood 5.44E-01 2.02E-02 4.37E-02
Sensitive skin EK0Z Skin 4.00E-01 -2.25E-02 -1.85E-01
Sepsis with septic shock 1G41 Whole blood 1.75E-09 7.34E-02 2.80E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.14E-02 -3.23E-01 -1.05E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.97E-02 3.32E-01 8.86E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.50E-01 7.68E-02 1.56E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.19E-01 -3.80E-01 -1.01E+00
Skin cancer 2C30-2C3Z Skin 4.18E-29 -6.99E-01 -1.56E+00
Thrombocythemia 3B63 Whole blood 1.25E-01 -7.99E-02 -5.45E-01
Thrombocytopenia 3B64 Whole blood 6.74E-01 1.72E-01 1.16E-01
Thyroid cancer 2D10 Thyroid 1.48E-04 -2.59E-01 -5.94E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.40E-08 9.34E-01 3.88E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.87E-02 6.98E-01 1.53E+00
Type 2 diabetes 5A11 Liver tissue 3.54E-01 -1.53E-01 -5.10E-01
Ureter cancer 2C92 Urothelium 5.11E-01 1.45E-02 4.70E-02
Uterine cancer 2C78 Endometrium tissue 1.09E-02 3.78E-01 3.30E-01
Vitiligo ED63.0 Skin 6.04E-01 -3.55E-02 -1.07E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Mfsd2a Is a Transporter for the Essential -3 Fatty Acid Docosahexaenoic Acid (DHA) in Eye and Is Important for Photoreceptor Cell Development. J Biol Chem. 2016 May 13;291(20):10501-14.
2 Mfsd2a is a transporter for the essential omega-3 fatty acid docosahexaenoic acid. Nature. 2014 May 22;509(7501):503-6.