Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT7RYVF)

DTP Name Sodium-driven chloride bicarbonate exchanger (SLC4A10)
Gene Name SLC4A10
UniProt ID
Q6U841 (S4A10_HUMAN)
VARIDT ID
DTD0381
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NBCn2; NCBE; SLC4A10; Solute carrier family 4 member 10
DTP Family Anion Exchanger (AE) Family ;
Sequence
MEIKDQGAQMEPLLPTRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLFIGVHVPLGGRK
SHRRHRHRGHKHRKRDRERDSGLEDGRESPSFDTPSQRVQFILGTEDDDEEHIPHDLFTE
LDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVL
LDMHANTLEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHHHQNQKKLTNRIPIVRSFA
DIGKKQSEPNSMDKNAGQVVSPQSAPACVENKNDVSRENSTVDFSKGLGGQQKGHTSPCG
MKQRHEKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQG
LAEVPIPTRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEF
LDQVTVLPPGEWDPSIRIEPPKNVPSQEKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTG
RIFGGLILDIKRKAPYFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRIS
AIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLW
TATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSEAYPINMHNDLE
LLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHP
YVPDVLFWSVILFFSTVTLSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIG
IPSPKLQVPSVFKPTRDDRGWFVTPLGPNPWWTVIAAIIPALLCTILIFMDQQITAVIIN
RKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQ
PKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQFFDRIK
LFWMPAKHQPDFIYLRHVPLRKVHLFTIIQMSCLGLLWIIKVSRAAIVFPMMVLALVFVR
KLMDLLFTKRELSWLDDLMPESKKKKLEDAEKEEEQSMLAMEDEGTVQLPLEGHYRDDPS
VINISDEMSKTALWRNLLITADNSKDKESSFPSKSSPS
Function This Electrogenic sodium/bicarbonate cotransporter Plays an important role in regulating intracellular pH and in exchange for intracellular chloride.
Endogenous Substrate(s) Cl-; Na+
TCDB ID
2.A.31.2.14
Gene ID
57282
Reactome Pathway
Bicarbonate transporters (R-HSA-425381 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium bicarbonate DMMU6BJ Metabolic acidosis 5C73 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.70E-01 -1.13E-02 -1.00E-01
Adrenocortical carcinoma 2D11.Z Kidney 4.82E-01 -1.24E-02 -9.96E-02
Alopecia ED70 Skin from scalp 2.16E-01 -2.06E-02 -1.41E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.01E-04 -8.76E-02 -5.66E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.54E-01 2.48E-02 2.54E-01
Aortic stenosis BB70 Calcified aortic valve 9.91E-01 1.25E-01 2.78E-01
Apnea 7A40 Hyperplastic tonsil 5.37E-01 7.73E-03 1.87E-01
Arthropathy FA00-FA5Z Peripheral blood 5.18E-01 2.51E-02 2.01E-01
Asthma CA23 Nasal and bronchial airway 2.82E-01 1.82E-02 1.45E-01
Atopic dermatitis EA80 Skin 8.15E-01 -5.01E-02 -7.83E-01
Autism 6A02 Whole blood 8.57E-03 1.04E-01 8.24E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.34E-01 -3.08E-02 -4.39E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.44E-01 -9.33E-02 -5.93E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.52E-01 2.20E-02 1.79E-01
Batten disease 5C56.1 Whole blood 2.93E-01 1.08E-01 8.66E-01
Behcet's disease 4A62 Peripheral blood 3.58E-01 -1.10E-01 -7.25E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.94E-01 -6.55E-03 -4.95E-02
Bladder cancer 2C94 Bladder tissue 6.68E-02 8.52E-02 9.99E-01
Breast cancer 2C60-2C6Z Breast tissue 5.02E-04 3.07E-02 2.52E-01
Cardioembolic stroke 8B11.20 Whole blood 7.03E-01 -2.51E-02 -1.78E-01
Cervical cancer 2C77 Cervical tissue 7.28E-02 -6.52E-02 -5.84E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.74E-01 4.75E-03 4.02E-02
Chronic hepatitis C 1E51.1 Whole blood 7.75E-01 -1.40E-02 -1.12E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.99E-01 -2.95E-02 -3.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.08E-01 4.86E-02 4.42E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.40E-01 4.45E-02 5.58E-01
Colon cancer 2B90 Colon tissue 1.15E-01 -1.65E-02 -8.89E-02
Coronary artery disease BA80-BA8Z Peripheral blood 2.52E-01 -2.98E-01 -1.03E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.00E-01 3.75E-02 3.29E-01
Endometriosis GA10 Endometrium tissue 2.33E-01 -5.05E-02 -3.50E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.87E-01 -9.84E-03 -1.32E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.54E-01 -2.17E-02 -1.72E-01
Gastric cancer 2B72 Gastric tissue 5.39E-01 -1.18E-01 -3.38E-01
Glioblastopma 2A00.00 Nervous tissue 3.81E-24 -9.63E-02 -4.94E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.36E-01 -5.35E-02 -3.29E-01
Head and neck cancer 2D42 Head and neck tissue 9.66E-01 2.35E-03 2.19E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.94E-01 -5.43E-02 -3.48E-01
Huntington's disease 8A01.10 Whole blood 2.30E-01 -2.83E-02 -2.40E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.32E-02 1.36E-01 1.36E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.09E-01 6.80E-02 7.71E-01
Influenza 1.00E+30 Whole blood 3.82E-01 4.41E-02 4.52E-01
Interstitial cystitis GC00.3 Bladder tissue 8.84E-01 4.03E-02 3.94E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.37E-01 6.11E-02 3.38E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.81E-01 3.03E-02 2.03E-01
Ischemic stroke 8B11 Peripheral blood 9.28E-01 -2.35E-02 -2.03E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.47E-01 4.43E-02 2.10E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.18E-01 6.40E-02 5.22E-01
Lateral sclerosis 8B60.4 Skin 9.76E-01 -3.26E-02 -2.66E-01
Liver cancer 2C12.0 Liver tissue 2.66E-02 -8.38E-02 -5.31E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.11E-01 -7.06E-02 -4.09E-01
Lung cancer 2C25 Lung tissue 8.49E-01 -2.09E-03 -1.58E-02
Lupus erythematosus 4A40 Whole blood 4.01E-02 -5.89E-02 -2.73E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.27E-01 -5.77E-03 -2.67E-02
Major depressive disorder 6A70-6A7Z Hippocampus 9.85E-01 1.12E-03 9.55E-03
Melanoma 2C30 Skin 7.95E-01 -3.33E-02 -2.18E-01
Multiple myeloma 2A83.1 Bone marrow 3.11E-04 1.12E-01 1.59E+00
Multiple myeloma 2A83.1 Peripheral blood 2.65E-01 2.49E-03 2.91E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.58E-01 0.00E+00 0.00E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.44E-01 1.88E-02 1.98E-01
Myelofibrosis 2A20.2 Whole blood 5.54E-04 -9.82E-02 -6.88E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.07E-01 1.14E-01 3.97E-01
Myopathy 8C70.6 Muscle tissue 6.62E-01 -1.17E-02 -6.47E-02
Neonatal sepsis KA60 Whole blood 1.11E-02 -4.53E-02 -2.90E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.69E-02 -1.09E-01 -7.05E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.83E-01 5.14E-02 6.58E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.74E-02 8.40E-02 2.01E+00
Olive pollen allergy CA08.00 Peripheral blood 3.05E-01 4.58E-02 5.55E-01
Oral cancer 2B6E Oral tissue 3.57E-01 1.69E-02 1.43E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.17E-01 -2.12E-02 -2.10E-01
Osteoporosis FB83.1 Bone marrow 5.47E-03 3.29E-01 3.46E+00
Ovarian cancer 2C73 Ovarian tissue 1.67E-01 -1.44E-01 -9.30E-01
Pancreatic cancer 2C10 Pancreas 5.25E-02 -9.10E-02 -6.31E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.61E-01 1.32E-02 2.08E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.19E-01 3.05E-02 4.56E-01
Pituitary cancer 2D12 Pituitary tissue 2.15E-01 -3.64E-02 -2.35E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.33E-01 -3.96E-02 -2.80E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.47E-01 -5.21E-03 -7.32E-02
Polycythemia vera 2A20.4 Whole blood 1.40E-01 -2.88E-02 -2.15E-01
Pompe disease 5C51.3 Biceps muscle 5.45E-01 -1.15E-03 -1.21E-02
Preterm birth KA21.4Z Myometrium 2.92E-01 -1.10E-01 -9.50E-01
Prostate cancer 2C82 Prostate 6.34E-01 -7.46E-02 -3.13E-01
Psoriasis EA90 Skin 1.05E-03 -5.74E-02 -3.02E-01
Rectal cancer 2B92 Rectal colon tissue 1.92E-01 -1.46E-01 -9.27E-01
Renal cancer 2C90-2C91 Kidney 6.13E-01 -1.09E-02 -8.18E-02
Retinoblastoma 2D02.2 Uvea 3.83E-02 -7.14E-02 -5.89E-01
Rheumatoid arthritis FA20 Synovial tissue 5.48E-01 -1.72E-02 -1.52E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.05E-01 3.85E-03 4.14E-02
Schizophrenia 6A20 Prefrontal cortex 1.71E-01 -1.37E-03 -8.89E-03
Schizophrenia 6A20 Superior temporal cortex 6.29E-01 1.53E-02 2.01E-01
Scleroderma 4A42.Z Whole blood 6.80E-02 9.07E-02 9.31E-01
Seizure 8A60-8A6Z Whole blood 1.35E-01 6.41E-02 7.02E-01
Sensitive skin EK0Z Skin 3.87E-01 6.80E-03 6.84E-02
Sepsis with septic shock 1G41 Whole blood 7.38E-02 -2.72E-02 -1.54E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.54E-01 4.01E-03 3.62E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.35E-01 2.06E-03 2.57E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 9.04E-02 6.71E-02 1.24E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.57E-01 -6.82E-02 -4.67E-01
Skin cancer 2C30-2C3Z Skin 6.05E-03 -4.54E-02 -2.51E-01
Thrombocythemia 3B63 Whole blood 1.35E-01 -1.05E-02 -7.77E-02
Thrombocytopenia 3B64 Whole blood 7.40E-01 -4.51E-02 -2.31E-01
Thyroid cancer 2D10 Thyroid 7.90E-02 1.50E-02 1.19E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.95E-02 -4.62E-02 -3.32E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.43E-01 2.30E-02 2.22E-01
Type 2 diabetes 5A11 Liver tissue 8.97E-01 -5.02E-02 -3.13E-01
Ureter cancer 2C92 Urothelium 6.07E-01 -6.35E-02 -3.72E-01
Uterine cancer 2C78 Endometrium tissue 8.50E-01 -4.17E-03 -2.51E-02
Vitiligo ED63.0 Skin 4.37E-01 2.82E-03 4.13E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Molecular mechanisms of electrogenic sodium bicarbonate cotransport: structural and equilibrium thermodynamic considerations. J Membr Biol. 2004 Jan 15;197(2):77-90.