Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTBGZ8H)

DTP Name Excitatory amino acid transporter 5 (SLC1A7)
Gene Name SLC1A7
UniProt ID
O00341 (EAA5_HUMAN)
VARIDT ID
DTD0135
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms EAAT5; Retinal glutamate transporter; SLC1A7; Solute carrier family 1 member 7
DTP Family Dicarboxylate/Amino Acid:Cation (Na(+) Or H(+)) Symporter (DAACS) Family ;
Tissue Specificity Expressed primarily in retina. Detectable inliver, heart, muscle and brain.
Sequence
MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRM
LKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAA
QKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPR
RILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMG
DSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTV
VCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNH
IDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKD
FARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEE
LPAASLNHCTIQISELETNV
Function This transporter is for L-glutamate; the L-glutamate uptake is sodium- and voltage-dependent and chloride-independent. Its associated chloride conductance may participate in visual processing.
Endogenous Substrate(s) Glutamate
TCDB ID
2.A.23.2.5
Gene ID
6512
KEGG Pathway
Synaptic vesicle cycle (hsa04721 )
Glutamatergic synapse (hsa04724 )
Reactome Pathway
Transport of inorganic cations/anions and amino acids/oligopeptides (R-HSA-425393 )
Glutamate Neurotransmitter Release Cycle (R-HSA-210500 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Glutamic Acid DM4PUDW Schizophrenia 6A20 Approved [4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.18E-05 -6.99E-02 -2.48E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.88E-01 -1.12E-01 -5.43E-01
Alopecia ED70 Skin from scalp 6.20E-02 -5.07E-02 -1.88E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.40E-04 1.19E-01 3.91E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.14E-01 -1.19E-01 -1.69E-01
Aortic stenosis BB70 Calcified aortic valve 5.48E-01 -9.75E-02 -2.97E-01
Apnea 7A40 Hyperplastic tonsil 5.29E-01 -1.48E-01 -7.09E-01
Arthropathy FA00-FA5Z Peripheral blood 3.98E-01 -4.08E-03 -1.23E-02
Asthma CA23 Nasal and bronchial airway 6.90E-03 -1.62E-01 -4.39E-01
Atopic dermatitis EA80 Skin 7.31E-02 6.03E-02 4.83E-01
Autism 6A02 Whole blood 4.84E-01 -1.04E-01 -3.39E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.03E-02 -1.11E-01 -7.90E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.52E-01 -1.35E-02 -7.04E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.10E-01 7.44E-02 3.22E-01
Batten disease 5C56.1 Whole blood 9.56E-02 3.33E-01 1.02E+00
Behcet's disease 4A62 Peripheral blood 1.89E-01 -3.53E-01 -7.39E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.00E-01 -7.11E-02 -3.37E-01
Bladder cancer 2C94 Bladder tissue 2.16E-05 6.05E-01 3.38E+00
Breast cancer 2C60-2C6Z Breast tissue 1.48E-20 -2.27E-01 -6.40E-01
Cardioembolic stroke 8B11.20 Whole blood 5.67E-01 2.11E-02 1.04E-01
Cervical cancer 2C77 Cervical tissue 3.63E-01 1.66E-01 5.78E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.15E-01 -6.55E-02 -2.73E-01
Chronic hepatitis C 1E51.1 Whole blood 8.39E-01 4.84E-03 2.42E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 4.13E-01 4.58E-02 2.05E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.28E-03 9.81E-02 4.79E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.26E-01 -2.34E-02 -1.17E-01
Colon cancer 2B90 Colon tissue 6.82E-08 -1.65E-02 -3.52E-02
Coronary artery disease BA80-BA8Z Peripheral blood 4.94E-01 -1.03E-01 -6.63E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.11E-01 -1.26E-01 -1.53E+00
Endometriosis GA10 Endometrium tissue 4.24E-01 7.08E-02 2.99E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.08E-01 -1.39E-01 -5.01E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.55E-03 -1.56E-01 -6.42E-01
Gastric cancer 2B72 Gastric tissue 6.73E-01 1.77E-01 3.28E-01
Glioblastopma 2A00.00 Nervous tissue 1.86E-01 -7.15E-02 -2.52E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.20E-06 -5.16E-01 -3.43E+00
Head and neck cancer 2D42 Head and neck tissue 3.61E-01 2.54E-02 1.02E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.24E-01 -9.83E-02 -4.65E-01
Huntington's disease 8A01.10 Whole blood 6.25E-01 5.97E-02 2.09E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.90E-02 8.10E-02 4.17E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.84E-01 7.97E-02 6.21E-01
Influenza 1.00E+30 Whole blood 9.70E-02 1.77E-01 1.81E+00
Interstitial cystitis GC00.3 Bladder tissue 4.40E-01 6.38E-03 1.23E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.81E-01 -6.59E-02 -3.08E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.84E-01 5.34E-04 2.95E-03
Ischemic stroke 8B11 Peripheral blood 7.51E-01 -5.71E-02 -1.53E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.60E-02 5.06E-02 1.74E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.25E-01 7.94E-02 2.85E-01
Lateral sclerosis 8B60.4 Skin 1.93E-01 1.02E-01 6.03E-01
Liver cancer 2C12.0 Liver tissue 5.80E-01 -2.02E-01 -4.30E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.12E-03 5.56E-01 1.56E+00
Lung cancer 2C25 Lung tissue 2.99E-15 -8.61E-02 -2.60E-01
Lupus erythematosus 4A40 Whole blood 1.21E-02 -1.07E-01 -3.04E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.89E-01 -5.83E-02 -2.22E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.94E-01 -1.18E-02 -6.20E-02
Melanoma 2C30 Skin 6.96E-01 -2.54E-02 -7.28E-02
Multiple myeloma 2A83.1 Bone marrow 5.51E-02 -1.77E-01 -6.04E-01
Multiple myeloma 2A83.1 Peripheral blood 2.08E-01 5.45E-02 2.99E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.78E-01 -1.75E-02 -8.84E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.64E-01 2.18E-04 1.26E-03
Myelofibrosis 2A20.2 Whole blood 2.36E-03 1.85E-01 1.49E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.48E-03 3.12E-01 7.89E-01
Myopathy 8C70.6 Muscle tissue 9.76E-02 3.30E-01 5.90E-01
Neonatal sepsis KA60 Whole blood 4.18E-02 -3.29E-02 -1.27E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.04E-01 -2.18E-01 -7.71E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.63E-01 -3.89E-02 -2.68E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.39E-03 2.23E-01 1.73E+00
Olive pollen allergy CA08.00 Peripheral blood 1.60E-02 2.02E-01 1.75E+00
Oral cancer 2B6E Oral tissue 4.81E-06 -4.08E-01 -1.08E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.75E-01 -4.98E-02 -1.46E-01
Osteoporosis FB83.1 Bone marrow 6.45E-01 6.74E-02 3.37E-01
Ovarian cancer 2C73 Ovarian tissue 1.68E-01 -7.16E-02 -1.89E-01
Pancreatic cancer 2C10 Pancreas 1.07E-01 1.20E-01 3.60E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.95E-01 -6.56E-02 -4.03E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.48E-02 -9.42E-02 -2.91E-01
Pituitary cancer 2D12 Pituitary tissue 2.70E-01 2.25E-02 1.06E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.33E-01 -1.54E-01 -6.82E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.69E-01 6.45E-02 4.17E-01
Polycythemia vera 2A20.4 Whole blood 9.86E-07 1.60E-01 1.43E+00
Pompe disease 5C51.3 Biceps muscle 8.58E-01 -6.96E-03 -3.84E-02
Preterm birth KA21.4Z Myometrium 9.60E-01 -3.48E-02 -1.36E-01
Prostate cancer 2C82 Prostate 2.62E-01 8.32E-02 2.45E-01
Psoriasis EA90 Skin 8.61E-01 3.78E-03 1.57E-02
Rectal cancer 2B92 Rectal colon tissue 3.93E-02 1.78E-01 5.88E-01
Renal cancer 2C90-2C91 Kidney 1.44E-01 -7.79E-02 -3.52E-01
Retinoblastoma 2D02.2 Uvea 7.37E-12 -4.06E+00 -2.26E+01
Rheumatoid arthritis FA20 Synovial tissue 5.02E-02 -3.08E-01 -7.99E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.74E-01 2.67E-02 2.11E-01
Schizophrenia 6A20 Prefrontal cortex 6.47E-01 7.42E-02 1.83E-01
Schizophrenia 6A20 Superior temporal cortex 7.41E-01 2.03E-02 1.64E-01
Scleroderma 4A42.Z Whole blood 2.19E-01 -1.38E-01 -7.82E-01
Seizure 8A60-8A6Z Whole blood 4.05E-01 4.49E-02 1.95E-01
Sensitive skin EK0Z Skin 7.19E-01 8.78E-02 7.30E-01
Sepsis with septic shock 1G41 Whole blood 4.05E-01 7.06E-03 2.56E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.46E-01 -3.66E-02 -2.28E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.70E-01 1.62E-02 1.01E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.56E-01 8.54E-02 3.64E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.55E-01 -1.66E-01 -1.27E+00
Skin cancer 2C30-2C3Z Skin 4.66E-16 -1.78E-01 -6.46E-01
Thrombocythemia 3B63 Whole blood 1.37E-02 1.70E-01 1.46E+00
Thrombocytopenia 3B64 Whole blood 6.28E-01 2.39E-02 6.54E-02
Thyroid cancer 2D10 Thyroid 5.35E-02 -4.93E-02 -2.01E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.09E-02 -3.26E-01 -6.92E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.35E-01 2.64E-01 1.53E+00
Type 2 diabetes 5A11 Liver tissue 4.18E-02 -1.59E-01 -1.61E+00
Ureter cancer 2C92 Urothelium 5.60E-01 2.68E-02 9.03E-02
Uterine cancer 2C78 Endometrium tissue 1.57E-02 4.05E-02 1.59E-01
Vitiligo ED63.0 Skin 6.21E-01 9.41E-03 3.32E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Excitatory amino acid transporter 5 (SLC1A7) DTT Info
DTP DTT Type Literature-reported
3 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-aspartic acid DM7Z892 Discovery agent N.A. Investigative [1]
DL-TBOA DM2HGNU Discovery agent N.A. Investigative [2]
[3H]ETB-TBOA DMWGY61 Discovery agent N.A. Investigative [3]
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 872).
2 Effects of threo-beta-hydroxyaspartate derivatives on excitatory amino acid transporters (EAAT4 and EAAT5). J Neurochem. 2001 Oct;79(2):297-302.
3 Characterization of the tritium-labeled analog of L-threo-beta-benzyloxyaspartate binding to glutamate transporters. Mol Pharmacol. 2007 Jan;71(1):294-302.
4 The SLC1 high-affinity glutamate and neutral amino acid transporter family. Mol Aspects Med. 2013 Apr-Jun;34(2-3):108-20.