Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTCL4P8)

DTP Name Electrogenic sodium bicarbonate cotransporter 4 (SLC4A5)
Gene Name SLC4A5
UniProt ID
Q9BY07 (S4A5_HUMAN)
VARIDT ID
DTD0386
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NBC4; NBCe2; SLC4A5; Solute carrier family 4 member 5
DTP Family Anion Exchanger (AE) Family ;
Sequence
MKVKEEKAGVGKLDHTNHRRRFPDQKECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWG
LRPDQPQQELTGPGSGASSQDSSMDLISRTRSPAAEQLQDILGEEDEAPNPTLFTEMDTL
QHDGDQMEWKESARWIKFEEKVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDS
GSLPQIIDDVIEKQIEDGLLRPELRERVSYVLLRRHRHQTKKPIHRSLADIGKSVSTTNR
SPARSPGAGPSLHHSTEDLRMRQSANYGRLCHAQSRSMNDISLTPNTDQRKNKFMKKIPK
DSEASNVLVGEVDFLDQPFIAFVRLIQSAMLGGVTEVPVPTRFLFILLGPSGRAKSYNEI
GRAIATLMVDDLFSDVAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSA
DKRKSVFSLAELGQMNGSVGGGGGAPGGGNGGGGGGGSGGGAGSGGAGGTSSGDDGEMPA
MHEIGEELIWTGRFFGGLCLDIKRKLPWFPSDFYDGFHIQSISAILFIYLGCITNAITFG
GLLGDATDNYQGVMESFLGTAMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKGNGL
DYMEFRLWIGLHSAVQCLILVATDASFIIKYITRFTEEGFSTLISFIFIYDAIKKMIGAF
KYYPINMDFKPNFITTYKCECVAPDTVNTTVFNASAPLAPDTNASLYNLLNLTALDWSLL
SKKECLSYGGRLLGNSCKFIPDLALMSFILFFGTYSMTLTLKKFKFSRYFPTKVRALVAD
FSIVFSILMFCGIDACFGLETPKLHVPSVIKPTRPDRGWFVAPFGKNPWWVYPASILPAL
LVTILIFMDQQITAVIVNRKENKLKKAAGYHLDLFWVGILMALCSFMGLPWYVAATVISI
AHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVF
LYMGVASLNGIQMGTGGSEFKIQKKLTPFWERCKLFLMPAKHQPDHAFLRHVPLRRIHLF
TLVQILCLAVLWILKSTVAAIIFPVMILGLIIVRRLLDFIFSQHDLAWIDNILPEKEKKE
TDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Function
This transporter regulates the pH of tissues and may play a role in mediating Na(+):HCO3(-) cotransport in hepatocytes and intrahepatic cholangiocytes. Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na(+):HCO3(-) stoichiometry of 2:1. Also may be important in protecting the renal paranchyma from alterations in urine pH.
Endogenous Substrate(s) Na+
TCDB ID
2.A.31.2.8
Gene ID
57835
KEGG Pathway
Bile secretion (hsa04976 )
Reactome Pathway
Bicarbonate transporters (R-HSA-425381 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium bicarbonate DMMU6BJ Metabolic acidosis 5C73 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.09E-07 1.11E-01 6.17E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.31E-01 -5.86E-03 -5.16E-02
Alopecia ED70 Skin from scalp 1.42E-01 4.57E-02 1.78E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.43E-01 -2.59E-02 -1.09E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.70E-01 8.40E-02 7.93E-01
Aortic stenosis BB70 Calcified aortic valve 4.84E-01 1.58E-01 3.54E-01
Apnea 7A40 Hyperplastic tonsil 1.50E-01 -1.21E-01 -8.60E-01
Arthropathy FA00-FA5Z Peripheral blood 3.97E-01 2.48E-02 1.39E-01
Asthma CA23 Nasal and bronchial airway 3.23E-03 -1.52E-01 -4.42E-01
Atopic dermatitis EA80 Skin 9.91E-02 2.40E-03 3.44E-02
Autism 6A02 Whole blood 4.06E-02 -1.25E-01 -5.35E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.65E-02 -1.62E-01 -8.24E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.23E-01 -1.34E-01 -6.16E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.39E-01 2.03E-02 8.06E-02
Batten disease 5C56.1 Whole blood 9.62E-01 -2.54E-02 -2.81E-01
Behcet's disease 4A62 Peripheral blood 4.96E-01 -1.31E-02 -1.39E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.62E-01 2.45E-03 1.58E-02
Bladder cancer 2C94 Bladder tissue 3.74E-03 2.47E-01 1.95E+00
Breast cancer 2C60-2C6Z Breast tissue 5.55E-02 7.33E-03 2.49E-02
Cardioembolic stroke 8B11.20 Whole blood 3.06E-02 -1.41E-01 -4.96E-01
Cervical cancer 2C77 Cervical tissue 7.82E-01 2.87E-02 1.38E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.82E-02 7.09E-02 3.31E-01
Chronic hepatitis C 1E51.1 Whole blood 9.63E-01 -5.99E-02 -3.89E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.92E-02 8.78E-02 4.52E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.82E-01 -1.61E-02 -7.26E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.12E-02 1.30E-01 1.23E+00
Colon cancer 2B90 Colon tissue 5.80E-07 -8.09E-02 -3.70E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.72E-01 -5.10E-02 -1.29E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.99E-02 -1.21E-01 -8.53E-01
Endometriosis GA10 Endometrium tissue 7.31E-01 -7.01E-03 -3.63E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.93E-01 -3.15E-03 -1.39E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.71E-03 -3.67E-01 -1.36E+00
Gastric cancer 2B72 Gastric tissue 3.66E-01 -3.78E-02 -1.61E-01
Glioblastopma 2A00.00 Nervous tissue 1.37E-11 -1.48E-01 -4.37E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.14E-01 1.28E-01 6.53E-01
Head and neck cancer 2D42 Head and neck tissue 1.64E-08 -1.35E-01 -5.90E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.40E-01 -4.20E-02 -1.51E-01
Huntington's disease 8A01.10 Whole blood 4.78E-01 1.40E-02 8.26E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.75E-02 2.97E-01 1.49E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.82E-02 -1.23E-01 -1.33E+00
Influenza 1.00E+30 Whole blood 2.74E-04 4.36E-01 5.50E+00
Interstitial cystitis GC00.3 Bladder tissue 3.69E-01 9.43E-02 3.82E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.59E-02 -2.66E-02 -1.81E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.85E-01 -3.75E-02 -1.86E-01
Ischemic stroke 8B11 Peripheral blood 3.70E-01 -5.27E-02 -3.38E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.03E-01 -1.36E-02 -5.28E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 4.81E-01 9.08E-02 3.93E-01
Lateral sclerosis 8B60.4 Skin 6.20E-01 6.09E-02 1.89E+00
Liver cancer 2C12.0 Liver tissue 1.73E-07 -2.16E-01 -1.03E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.66E-01 1.75E-02 1.11E-01
Lung cancer 2C25 Lung tissue 8.49E-02 -5.07E-02 -2.54E-01
Lupus erythematosus 4A40 Whole blood 4.77E-04 -6.90E-02 -3.02E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.02E-02 4.65E-02 2.11E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.33E-01 1.18E-02 7.48E-02
Melanoma 2C30 Skin 8.84E-01 4.58E-02 1.39E-01
Multiple myeloma 2A83.1 Bone marrow 4.44E-02 1.90E-01 4.54E-01
Multiple myeloma 2A83.1 Peripheral blood 5.83E-01 3.24E-03 2.80E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.08E-02 1.98E-01 5.68E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.63E-01 -7.69E-02 -4.58E-01
Myelofibrosis 2A20.2 Whole blood 3.15E-01 -1.93E-02 -1.48E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.19E-01 -1.84E-02 -4.78E-02
Myopathy 8C70.6 Muscle tissue 3.49E-01 -1.38E-01 -5.41E-01
Neonatal sepsis KA60 Whole blood 6.60E-01 -3.92E-02 -1.42E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.97E-03 -3.01E-01 -1.17E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.52E-02 1.22E-01 1.00E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.72E-01 -3.53E-03 -2.08E-02
Olive pollen allergy CA08.00 Peripheral blood 6.82E-02 9.50E-02 1.64E+00
Oral cancer 2B6E Oral tissue 4.12E-02 -9.38E-02 -3.90E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.87E-01 8.50E-02 6.03E-01
Osteoporosis FB83.1 Bone marrow 3.03E-02 3.71E-01 1.96E+00
Ovarian cancer 2C73 Ovarian tissue 8.63E-01 -6.11E-02 -5.24E-01
Pancreatic cancer 2C10 Pancreas 1.05E-03 -2.62E-01 -6.52E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.77E-02 -7.60E-02 -4.17E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.90E-03 5.07E-02 7.58E-01
Pituitary cancer 2D12 Pituitary tissue 6.22E-01 -1.29E-02 -7.35E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.65E-01 2.74E-02 9.69E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.25E-02 3.89E-02 2.52E-01
Polycythemia vera 2A20.4 Whole blood 9.23E-01 1.52E-02 1.10E-01
Pompe disease 5C51.3 Biceps muscle 3.20E-01 -9.10E-02 -7.60E-01
Preterm birth KA21.4Z Myometrium 3.46E-01 -5.76E-02 -3.36E-01
Prostate cancer 2C82 Prostate 2.25E-02 -4.82E-01 -9.58E-01
Psoriasis EA90 Skin 8.33E-07 -1.74E-01 -6.63E-01
Rectal cancer 2B92 Rectal colon tissue 1.20E-01 -1.54E-01 -7.32E-01
Renal cancer 2C90-2C91 Kidney 3.37E-01 -9.16E-02 -6.03E-01
Retinoblastoma 2D02.2 Uvea 1.86E-10 -9.38E-01 -3.57E+00
Rheumatoid arthritis FA20 Synovial tissue 8.12E-01 5.59E-02 2.56E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.40E-02 -7.38E-02 -5.36E-01
Schizophrenia 6A20 Prefrontal cortex 8.23E-01 -9.26E-03 -4.08E-02
Schizophrenia 6A20 Superior temporal cortex 6.99E-01 -1.26E-02 -1.24E-01
Scleroderma 4A42.Z Whole blood 6.23E-02 1.47E-01 1.28E+00
Seizure 8A60-8A6Z Whole blood 2.99E-01 1.96E-02 8.16E-02
Sensitive skin EK0Z Skin 8.58E-01 9.77E-03 8.90E-02
Sepsis with septic shock 1G41 Whole blood 3.96E-01 -1.64E-02 -5.34E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.84E-01 1.36E-01 8.00E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.26E-01 1.78E-01 5.56E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.14E-01 6.90E-02 3.02E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.09E-01 -1.01E-01 -6.17E-01
Skin cancer 2C30-2C3Z Skin 3.78E-11 -1.38E-01 -5.48E-01
Thrombocythemia 3B63 Whole blood 6.84E-01 7.37E-03 6.08E-02
Thrombocytopenia 3B64 Whole blood 9.32E-02 1.62E-01 8.01E-01
Thyroid cancer 2D10 Thyroid 6.49E-07 -5.90E-01 -8.57E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.99E-01 -6.85E-02 -3.88E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.61E-01 2.77E-01 1.81E+00
Type 2 diabetes 5A11 Liver tissue 3.59E-01 -1.75E-01 -8.24E-01
Ureter cancer 2C92 Urothelium 9.43E-01 5.66E-02 2.59E-01
Uterine cancer 2C78 Endometrium tissue 4.40E-07 -1.47E-01 -6.33E-01
Vitiligo ED63.0 Skin 2.81E-03 9.16E-02 1.02E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The sodium bicarbonate cotransporter: structure, function, and regulation. Semin Nephrol. 2006 Sep;26(5):352-60.