Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTD815L)

DTP Name Sodium-coupled neutral amino acid transporter 1 (SLC38A1)
Gene Name SLC38A1
UniProt ID
Q9H2H9 (S38A1_HUMAN)
VARIDT ID
DTD0326
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ATA1; Amino acid transporter A1; N-system amino acid transporter 2; NAT2; SLC38A1; SNAT1; Solute carrier family 38 member 1; System A amino acid transporter 1; System N amino acid transporter 1
DTP Family Amino Acid/Auxin Permease (AAAP) Family ;
Tissue Specificity Expressed in the cerebral cortex by pyramidaland GABAergic neurons, astrocytes and other non-neuronal cells (atprotein level). Expressed in placenta, heart, lung, skeletalmuscle, spleen, stomach and testis.
Sequence
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK
DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH
Function
This sodium-dependent amino acid transporter mediates the saturable, pH-sensitive and electrogenic cotransport of glutamine and sodium ions with a stoichiometry of 1:1. May also transport small zwitterionic and aliphatic amino acids with a lower affinity. May supply glutamatergic and GABAergic neurons with glutamine which is required for the synthesis of the neurotransmitters glutamate and GABA.
Endogenous Substrate(s) Glutamine; Sodium ions; Zwitterionic amino acids; Aliphatic amino acids
TCDB ID
2.A.18.6.14
Gene ID
81539
KEGG Pathway
Glutamatergic synapse (hsa04724 )
GABAergic synapse (hsa04727 )
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )
Astrocytic Glutamate-Glutamine Uptake And Metabolism (R-HSA-210455 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Alanine DMZDN4W Dietary shortage 5B5K Approved [1]
L-glutamine DM69G8X Short bowel syndrome KB89.1 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.92E-01 -3.74E-02 -6.51E-02
Adrenocortical carcinoma 2D11.Z Kidney 4.91E-02 3.06E-01 7.51E-01
Alopecia ED70 Skin from scalp 7.49E-02 -6.09E-02 -2.45E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.02E-01 1.09E-01 2.98E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.78E-01 -2.63E-01 -5.04E-01
Aortic stenosis BB70 Calcified aortic valve 3.81E-01 8.38E-02 9.50E-02
Apnea 7A40 Hyperplastic tonsil 1.78E-01 4.92E-01 8.39E-01
Arthropathy FA00-FA5Z Peripheral blood 7.69E-02 -2.06E-01 -6.03E-01
Asthma CA23 Nasal and bronchial airway 4.36E-05 2.04E-01 4.56E-01
Atopic dermatitis EA80 Skin 9.84E-02 2.58E-01 6.70E-01
Autism 6A02 Whole blood 8.81E-01 -1.07E-01 -2.28E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.14E-01 7.29E-02 2.93E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.08E-01 -4.15E-01 -6.92E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.45E-02 -9.66E-02 -2.81E-01
Batten disease 5C56.1 Whole blood 4.56E-01 -1.59E-01 -5.82E-01
Behcet's disease 4A62 Peripheral blood 1.02E-01 -1.23E-01 -5.04E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.01E-01 -4.50E-02 -1.23E-01
Bladder cancer 2C94 Bladder tissue 9.75E-01 7.71E-03 2.21E-02
Breast cancer 2C60-2C6Z Breast tissue 7.93E-14 4.76E-01 4.23E-01
Cardioembolic stroke 8B11.20 Whole blood 9.30E-04 -3.10E-01 -1.12E+00
Cervical cancer 2C77 Cervical tissue 1.66E-01 9.92E-02 1.24E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.63E-01 -3.44E-01 -3.26E-01
Chronic hepatitis C 1E51.1 Whole blood 5.76E-01 -5.12E-02 -1.22E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.35E-01 8.55E-03 3.34E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.74E-02 -6.22E-02 -1.60E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.82E-01 1.71E-01 6.09E-01
Colon cancer 2B90 Colon tissue 1.19E-02 -4.60E-02 -1.38E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.52E-01 -6.36E-01 -8.57E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.36E-01 -7.34E-02 -2.63E-01
Endometriosis GA10 Endometrium tissue 1.04E-01 9.83E-01 8.30E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.43E-01 1.02E-01 5.71E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.57E-11 -2.48E+00 -2.56E+00
Gastric cancer 2B72 Gastric tissue 5.84E-01 9.36E-01 9.97E-01
Glioblastopma 2A00.00 Nervous tissue 4.69E-41 -6.42E-01 -1.15E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.12E-05 1.23E+00 2.07E+00
Head and neck cancer 2D42 Head and neck tissue 5.01E-19 8.92E-01 1.44E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.77E-01 8.58E-03 1.61E-02
Huntington's disease 8A01.10 Whole blood 5.32E-01 9.02E-02 2.47E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.31E-02 -8.37E-01 -2.22E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.28E-02 -9.17E-02 -5.72E-01
Influenza 1.00E+30 Whole blood 2.42E-01 2.49E-01 5.94E-01
Interstitial cystitis GC00.3 Bladder tissue 7.54E-02 -3.39E-01 -1.60E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.50E-04 -8.98E-01 -1.66E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.70E-01 3.33E-02 1.75E-01
Ischemic stroke 8B11 Peripheral blood 8.16E-01 -2.25E-01 -3.85E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.29E-01 -3.59E-02 -1.47E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.54E-01 -9.98E-03 -2.07E-02
Lateral sclerosis 8B60.4 Skin 7.17E-01 9.14E-02 1.14E-01
Liver cancer 2C12.0 Liver tissue 7.48E-05 1.10E+00 1.08E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.85E-03 8.64E-01 1.67E+00
Lung cancer 2C25 Lung tissue 1.51E-27 4.82E-01 1.35E+00
Lupus erythematosus 4A40 Whole blood 3.07E-13 -4.73E-01 -7.69E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.33E-02 -8.68E-02 -3.09E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.55E-01 -1.75E-01 -4.78E-01
Melanoma 2C30 Skin 4.52E-01 -1.49E-01 -1.68E-01
Multiple myeloma 2A83.1 Bone marrow 4.56E-06 1.38E+00 4.40E+00
Multiple myeloma 2A83.1 Peripheral blood 1.43E-01 -5.59E-02 -1.70E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.88E-02 3.01E-01 1.13E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.07E-04 -4.43E-01 -7.70E-01
Myelofibrosis 2A20.2 Whole blood 1.43E-03 -5.79E-01 -1.66E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.54E-01 -9.06E-02 -1.79E-01
Myopathy 8C70.6 Muscle tissue 6.01E-03 1.19E+00 1.90E+00
Neonatal sepsis KA60 Whole blood 1.17E-28 -1.34E+00 -2.30E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.23E-04 -7.26E-01 -1.57E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.66E-01 1.98E-01 7.71E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.28E-02 -7.58E-01 -1.71E+00
Olive pollen allergy CA08.00 Peripheral blood 6.74E-01 -4.90E-01 -5.36E-01
Oral cancer 2B6E Oral tissue 7.46E-10 1.17E+00 2.17E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.38E-01 -1.40E-01 -3.21E-01
Osteoporosis FB83.1 Bone marrow 1.12E-01 -5.45E-01 -4.94E-01
Ovarian cancer 2C73 Ovarian tissue 4.90E-04 1.40E+00 1.71E+00
Pancreatic cancer 2C10 Pancreas 4.53E-01 1.46E-02 2.57E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 9.23E-01 1.45E-02 2.57E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.97E-03 -3.74E-01 -1.10E+00
Pituitary cancer 2D12 Pituitary tissue 9.25E-01 -6.30E-02 -1.49E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.80E-01 -1.98E-01 -4.84E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.42E-03 -6.54E-01 -1.22E+00
Polycythemia vera 2A20.4 Whole blood 7.12E-16 -7.84E-01 -2.22E+00
Pompe disease 5C51.3 Biceps muscle 4.20E-04 1.14E+00 2.55E+00
Preterm birth KA21.4Z Myometrium 1.56E-01 4.44E-01 1.30E+00
Prostate cancer 2C82 Prostate 7.16E-02 -1.18E-01 -2.88E-01
Psoriasis EA90 Skin 4.63E-04 -5.19E-02 -1.76E-01
Rectal cancer 2B92 Rectal colon tissue 1.04E-01 3.47E-01 8.25E-01
Renal cancer 2C90-2C91 Kidney 7.29E-05 9.44E-01 2.08E+00
Retinoblastoma 2D02.2 Uvea 2.86E-08 -2.92E+00 -1.31E+01
Rheumatoid arthritis FA20 Synovial tissue 4.42E-02 -5.52E-01 -1.53E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.53E-01 1.78E-02 7.88E-02
Schizophrenia 6A20 Prefrontal cortex 6.42E-01 3.61E-02 5.49E-02
Schizophrenia 6A20 Superior temporal cortex 9.71E-01 -5.52E-02 -1.76E-01
Scleroderma 4A42.Z Whole blood 1.08E-06 -4.47E-01 -2.89E+00
Seizure 8A60-8A6Z Whole blood 9.01E-01 1.21E-01 1.84E-01
Sensitive skin EK0Z Skin 8.09E-01 1.38E-02 6.92E-02
Sepsis with septic shock 1G41 Whole blood 1.33E-67 -1.12E+00 -2.10E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.74E-01 -4.08E-01 -5.21E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.19E-03 -7.66E-01 -1.49E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.91E-01 6.44E-02 2.29E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.45E-01 2.13E-01 5.20E-01
Skin cancer 2C30-2C3Z Skin 7.27E-42 -1.52E+00 -2.45E+00
Thrombocythemia 3B63 Whole blood 4.48E-04 -5.46E-01 -1.61E+00
Thrombocytopenia 3B64 Whole blood 6.26E-01 -1.15E-01 -1.78E-01
Thyroid cancer 2D10 Thyroid 1.92E-21 -6.84E-01 -1.53E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.52E-01 8.00E-02 1.24E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.55E-01 4.94E-03 9.34E-03
Type 2 diabetes 5A11 Liver tissue 6.57E-02 3.97E-01 1.43E+00
Ureter cancer 2C92 Urothelium 8.07E-03 2.86E-01 1.32E+00
Uterine cancer 2C78 Endometrium tissue 8.97E-44 1.67E+00 2.10E+00
Vitiligo ED63.0 Skin 4.82E-02 1.12E-01 1.04E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 38 member 1 (SLC38A1) DTT Info
DTP DTT Type Literature-reported

References

1 Identification of SLC38A7 (SNAT7) protein as a glutamine transporter expressed in neurons. J Biol Chem. 2011 Jun 10;286(23):20500-11.