Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTDEWVR)

DTP Name	Acetyl-coenzyme A transporter 1 (SLC33A1)
Gene Name	SLC33A1
UniProt ID	O00400 (ACATN_HUMAN)
VARIDT ID	DTD0282
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Synonyms	ACATN; AT-1; AT1; Acetyl-CoA transporter 1; CCHLND; SLC33A1; SPG42; Solute carrier family 33 member 1
DTP Family	Major Facilitator Superfamily (MFS)
DTP Family	Peptide/Acetyl-Coenzyme A/Drug Transporter (PAT) Family
Tissue Specificity	Ubiquitous. Detected in heart, brain,placenta, lung, liver, skeletal muscle, kidney and pancreas. Withstrongest signals in pancreas.
Sequence	MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGD FLKAPQSFRAELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFS LKLLWAPLVDAVYVKNFGRRKSWLVPTQYILGLFMIYLSTQVDRLLGNTDDRTPDVIALT VAFFLFEFLAATQDIAVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADF CNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKKENEVSVVKEETQGITDTYKL LFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVEEGVPKEHLALLAVPMVPLQIILP LIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIVVLLSYAL HQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECV GASNQNCRTPDAVELCKKLGGSCVTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGS SSWKCKRNN
Function	This transporter is necessary for O-acetylation of gangliosides.
Endogenous Substrate(s)	Acetyl-CoA; Coenzyme A
TCDB ID	2.A.1.25.1
Gene ID	9197
KEGG Pathway	Glycosphingolipid biosynthesis - ganglio series (hsa00604 ) Metabolic pathways (hsa01100 )
Reactome Pathway	Defective SLC33A1 causes spastic paraplegia 42 (SPG42) (R-HSA-5619061 ) Transport of vitamins, nucleosides, and related molecules (R-HSA-425397 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	7.80E-09	-1.73E-01	-4.99E-01
Adrenocortical carcinoma	2D11.Z	Kidney	5.75E-03	-5.03E-01	-1.14E+00
Alopecia	ED70	Skin from scalp	2.79E-02	1.75E-01	5.55E-01
Alzheimer's disease	8A20	Entorhinal cortex	4.99E-01	4.89E-02	2.73E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	2.50E-01	2.01E-01	8.63E-01
Aortic stenosis	BB70	Calcified aortic valve	3.66E-01	-5.01E-02	-1.88E-01
Apnea	7A40	Hyperplastic tonsil	7.06E-02	1.25E-01	9.31E-01
Arthropathy	FA00-FA5Z	Peripheral blood	7.94E-01	1.00E-02	4.02E-02
Asthma	CA23	Nasal and bronchial airway	9.47E-01	-3.94E-02	-1.13E-01
Atopic dermatitis	EA80	Skin	1.51E-01	-2.15E-01	-6.39E-01
Autism	6A02	Whole blood	2.41E-01	1.17E-01	4.78E-01
Autoimmune uveitis	9A96	Peripheral monocyte	9.21E-02	4.34E-01	1.60E+00
Autosomal dominant monocytopenia	4B04	Whole blood	2.06E-01	4.15E-01	1.31E+00
Bacterial infection of gingival	1C1H	Gingival tissue	1.33E-09	2.56E-01	1.04E+00
Batten disease	5C56.1	Whole blood	2.19E-01	-6.00E-01	-1.95E+00
Behcet's disease	4A62	Peripheral blood	6.47E-01	-3.27E-02	-9.02E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	2.48E-01	-6.58E-02	-5.34E-01
Bladder cancer	2C94	Bladder tissue	3.24E-03	-3.78E-01	-1.74E+00
Breast cancer	2C60-2C6Z	Breast tissue	6.41E-74	4.14E-01	1.52E+00
Cardioembolic stroke	8B11.20	Whole blood	4.23E-04	3.04E-01	1.47E+00
Cervical cancer	2C77	Cervical tissue	7.72E-06	4.19E-01	1.20E+00
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	8.24E-01	-9.64E-02	-1.61E-01
Chronic hepatitis C	1E51.1	Whole blood	8.10E-01	1.58E-02	1.02E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	8.70E-02	-2.65E-02	-9.16E-02
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	2.14E-03	-1.10E-01	-4.74E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	1.01E-01	1.28E-01	5.17E-01
Colon cancer	2B90	Colon tissue	1.60E-03	9.62E-02	2.28E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	2.11E-01	2.67E-02	1.94E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	5.98E-01	3.10E-02	9.28E-02
Endometriosis	GA10	Endometrium tissue	6.19E-01	-2.90E-02	-6.88E-02
Familial hypercholesterolemia	5C80.00	Peripheral blood	5.88E-01	-3.61E-03	-2.16E-02
Familial hypercholesterolemia	5C80.00	Whole blood	3.80E-07	6.28E-01	1.55E+00
Gastric cancer	2B72	Gastric tissue	1.24E-01	5.27E-01	1.43E+00
Glioblastopma	2A00.00	Nervous tissue	7.43E-87	4.35E-01	1.39E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	1.73E-01	2.02E-01	4.72E-01
Head and neck cancer	2D42	Head and neck tissue	1.45E-09	3.15E-01	9.03E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	9.94E-01	-1.13E-01	-3.89E-01
Huntington's disease	8A01.10	Whole blood	8.33E-01	-3.08E-02	-2.43E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	9.34E-02	-4.48E-01	-1.33E+00
Immunodeficiency	4A00-4A20	Peripheral blood	8.46E-02	-1.51E-01	-1.04E+00
Influenza	1.00E+30	Whole blood	1.04E-02	-1.47E+00	-3.52E+00
Interstitial cystitis	GC00.3	Bladder tissue	2.43E-01	2.12E-01	7.10E-01
Intracranial aneurysm	8B01.0	Intracranial artery	1.71E-01	4.67E-01	6.99E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	3.50E-01	2.39E-03	9.05E-03
Ischemic stroke	8B11	Peripheral blood	5.46E-01	-7.61E-02	-1.74E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	4.89E-01	-1.21E-01	-1.81E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	9.19E-01	-1.12E-01	-5.85E-01
Lateral sclerosis	8B60.4	Skin	6.47E-01	-1.87E-01	-5.05E-01
Liver cancer	2C12.0	Liver tissue	5.90E-01	8.36E-02	1.43E-01
Liver failure	DB99.7-DB99.8	Liver tissue	9.19E-06	-9.09E-01	-3.54E+00
Lung cancer	2C25	Lung tissue	1.63E-37	3.71E-01	1.13E+00
Lupus erythematosus	4A40	Whole blood	3.37E-02	2.01E-01	4.36E-01
Major depressive disorder	6A70-6A7Z	Whole blood	4.40E-01	9.95E-03	2.90E-02
Major depressive disorder	6A70-6A7Z	Hippocampus	1.78E-01	-2.50E-02	-2.45E-01
Melanoma	2C30	Skin	9.37E-01	-9.97E-02	-1.49E-01
Multiple myeloma	2A83.1	Bone marrow	2.19E-01	1.64E-01	1.05E+00
Multiple myeloma	2A83.1	Peripheral blood	9.39E-01	-1.12E-01	-3.83E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	1.40E-01	-2.75E-01	-1.23E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	7.45E-01	-1.78E-01	-4.16E-01
Myelofibrosis	2A20.2	Whole blood	4.86E-01	4.31E-03	2.08E-02
Myocardial infarction	BA41-BA50	Peripheral blood	1.43E-03	-4.01E-01	-5.78E-01
Myopathy	8C70.6	Muscle tissue	4.50E-02	1.40E-01	4.35E-01
Neonatal sepsis	KA60	Whole blood	6.07E-01	-1.71E-01	-4.53E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.66E-05	1.03E+00	2.58E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	7.26E-01	-6.39E-03	-3.28E-02
Obesity related type 2 diabetes	5A11	Omental adipose tissue	4.14E-02	-3.98E-01	-1.46E+00
Olive pollen allergy	CA08.00	Peripheral blood	5.82E-01	4.21E-02	2.14E-01
Oral cancer	2B6E	Oral tissue	4.03E-09	6.22E-01	1.57E+00
Osteoarthritis	FA00-FA0Z	Synovial tissue	1.48E-01	3.66E-01	8.04E-01
Osteoporosis	FB83.1	Bone marrow	1.92E-01	-3.56E-01	-9.62E-01
Ovarian cancer	2C73	Ovarian tissue	2.86E-05	7.41E-01	2.50E+00
Pancreatic cancer	2C10	Pancreas	1.67E-01	2.60E-01	5.77E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	1.99E-01	1.69E-01	5.06E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	8.46E-01	5.38E-02	2.18E-01
Pituitary cancer	2D12	Pituitary tissue	6.44E-06	-8.69E-01	-2.62E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	5.06E-08	-8.40E-01	-3.60E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	6.08E-01	3.22E-02	2.44E-01
Polycythemia vera	2A20.4	Whole blood	2.43E-02	2.75E-04	1.19E-03
Pompe disease	5C51.3	Biceps muscle	3.91E-01	-2.23E-02	-1.37E-01
Preterm birth	KA21.4Z	Myometrium	3.99E-01	-3.56E-01	-4.86E-01
Prostate cancer	2C82	Prostate	9.94E-04	6.33E-01	1.04E+00
Psoriasis	EA90	Skin	3.42E-01	-5.08E-02	-1.67E-01
Rectal cancer	2B92	Rectal colon tissue	8.14E-01	-6.82E-02	-3.31E-01
Renal cancer	2C90-2C91	Kidney	3.60E-04	6.66E-01	1.78E+00
Retinoblastoma	2D02.2	Uvea	4.69E-01	-1.72E-02	-1.00E-01
Rheumatoid arthritis	FA20	Synovial tissue	3.10E-03	6.32E-01	1.64E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	1.03E-02	7.64E-02	5.15E-01
Schizophrenia	6A20	Prefrontal cortex	7.79E-01	-4.30E-02	-8.65E-02
Schizophrenia	6A20	Superior temporal cortex	6.04E-01	-3.25E-02	-2.04E-01
Scleroderma	4A42.Z	Whole blood	5.79E-02	-9.93E-02	-5.86E-01
Seizure	8A60-8A6Z	Whole blood	8.69E-01	2.15E-01	5.00E-01
Sensitive skin	EK0Z	Skin	9.70E-01	1.31E-01	3.67E-01
Sepsis with septic shock	1G41	Whole blood	1.05E-17	-2.62E-01	-9.33E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	1.57E-01	-4.75E-01	-7.28E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	1.34E-03	-4.60E-01	-1.85E+00
Simpson golabi behmel syndrome	LD2C	Adipose tissue	4.71E-01	-2.67E-01	-2.19E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	7.49E-01	-2.56E-01	-4.04E-01
Skin cancer	2C30-2C3Z	Skin	1.23E-05	1.02E-01	3.49E-01
Thrombocythemia	3B63	Whole blood	4.81E-03	-1.58E-01	-7.88E-01
Thrombocytopenia	3B64	Whole blood	6.27E-01	-1.30E-01	-2.11E-01
Thyroid cancer	2D10	Thyroid	8.72E-52	-9.28E-01	-2.62E+00
Tibial muscular dystrophy	8C75	Muscle tissue	4.80E-05	3.66E-01	2.28E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	4.17E-01	-1.91E-01	-5.13E-01
Type 2 diabetes	5A11	Liver tissue	8.71E-01	-1.03E-01	-1.12E+00
Ureter cancer	2C92	Urothelium	4.26E-01	7.13E-02	5.46E-01
Uterine cancer	2C78	Endometrium tissue	2.89E-01	7.35E-02	1.27E-01
Vitiligo	ED63.0	Skin	5.26E-01	-2.20E-02	-1.56E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name

Acetyl-CoA transporter (SLC33A1) DTT Info

DTP DTT Type

Patented-recorded

3 Patented Agent(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
US8592431, 181	DM29KS1	N. A.	N. A.	Patented	[1]
US8592431, 185	DM1K5HS	N. A.	N. A.	Patented	[1]
US8592431, 457	DMAPGBF	N. A.	N. A.	Patented	[1]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
[14C]acetylCoA	DM42B5D	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

References

1	Fused ring compound and use thereof. US8592431.
2	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1134).