Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTDPJ3F)

DTP Name Mitochondrial ornithine transporter 2 (SLC25A2)
Gene Name SLC25A2
UniProt ID
Q9BXI2 (ORNT2_HUMAN)
VARIDT ID
DTD0179
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ORC2; ORNT2; SLC25A2; Solute carrier family 25 member 2
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Expressed in liver, kidney, pancreas andcultured fibroblasts.
Sequence
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGL
RGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFA
ALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQE
VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVL
SMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
Y
Function This transporter mediates ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Endogenous Substrate(s) Citrulline; H+
TCDB ID
2.A.29.19.1
Gene ID
83884
Reactome Pathway
Urea cycle (R-HSA-70635 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Arginine DMRE4FC Growth hormone deficiency 5A61.3 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.42E-01 2.47E-03 1.74E-02
Adrenocortical carcinoma 2D11.Z Kidney 7.41E-01 6.92E-03 2.52E-02
Alopecia ED70 Skin from scalp 5.78E-01 1.74E-02 4.49E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.94E-01 -1.19E-02 -6.74E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.22E-01 7.84E-02 5.73E-01
Aortic stenosis BB70 Calcified aortic valve 1.30E-01 2.48E-01 9.67E-01
Apnea 7A40 Hyperplastic tonsil 1.58E-01 8.24E-02 4.10E-01
Arthropathy FA00-FA5Z Peripheral blood 5.61E-01 3.95E-02 2.50E-01
Asthma CA23 Nasal and bronchial airway 9.59E-05 -1.23E-01 -3.53E-01
Atopic dermatitis EA80 Skin 4.35E-01 -4.06E-02 -3.46E-01
Autism 6A02 Whole blood 3.15E-01 -2.64E-02 -1.27E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.55E-01 -1.31E-01 -7.00E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.37E-01 -2.14E-03 -1.20E-02
Bacterial infection of gingival 1C1H Gingival tissue 6.13E-06 -9.98E-02 -5.27E-01
Batten disease 5C56.1 Whole blood 5.77E-01 4.62E-02 3.87E-01
Behcet's disease 4A62 Peripheral blood 4.71E-01 1.14E-01 4.80E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.98E-01 -4.01E-03 -2.53E-02
Bladder cancer 2C94 Bladder tissue 6.81E-03 2.77E-01 1.11E+00
Breast cancer 2C60-2C6Z Breast tissue 6.40E-02 -4.94E-02 -1.65E-01
Cardioembolic stroke 8B11.20 Whole blood 3.36E-01 1.91E-02 7.96E-02
Cervical cancer 2C77 Cervical tissue 1.25E-03 -7.26E-02 -3.74E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.14E-01 -6.25E-02 -3.12E-01
Chronic hepatitis C 1E51.1 Whole blood 1.32E-01 9.76E-02 4.05E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.54E-01 4.64E-02 2.48E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.05E-02 3.35E-02 2.07E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.02E-01 0.00E+00 0.00E+00
Colon cancer 2B90 Colon tissue 1.26E-05 7.64E-02 3.54E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.73E-01 -4.98E-02 -5.24E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.50E-01 -2.52E-01 -1.23E+00
Endometriosis GA10 Endometrium tissue 9.51E-02 5.40E-02 2.66E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.51E-01 1.09E-01 5.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.99E-02 -1.24E-01 -5.71E-01
Gastric cancer 2B72 Gastric tissue 2.56E-03 -7.29E-02 -4.16E+00
Glioblastopma 2A00.00 Nervous tissue 5.04E-13 1.44E-01 5.33E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.43E-01 -1.61E-02 -6.42E-02
Head and neck cancer 2D42 Head and neck tissue 3.10E-05 -8.40E-02 -4.51E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.09E-01 -3.60E-02 -1.40E-01
Huntington's disease 8A01.10 Whole blood 4.22E-01 -8.93E-02 -5.63E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.08E-01 -8.48E-02 -5.11E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.83E-01 2.62E-02 2.59E-01
Influenza 1.00E+30 Whole blood 4.40E-01 1.10E-01 4.12E-01
Interstitial cystitis GC00.3 Bladder tissue 5.51E-01 -8.99E-02 -3.69E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.35E-01 3.64E-02 1.60E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.96E-01 8.80E-02 2.12E-01
Ischemic stroke 8B11 Peripheral blood 6.27E-01 1.62E-02 7.19E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 9.22E-02 6.05E-02 1.92E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.69E-01 -1.20E-01 -5.87E-01
Lateral sclerosis 8B60.4 Skin 7.16E-01 1.14E-02 7.10E-02
Liver cancer 2C12.0 Liver tissue 2.74E-04 -2.10E-01 -8.22E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.68E-02 -2.30E-01 -1.06E+00
Lung cancer 2C25 Lung tissue 2.58E-18 1.53E-01 7.70E-01
Lupus erythematosus 4A40 Whole blood 4.07E-01 -9.99E-02 -2.78E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.64E-01 7.50E-02 2.20E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.17E-01 2.75E-02 2.10E-01
Melanoma 2C30 Skin 7.81E-01 2.07E-02 4.51E-02
Multiple myeloma 2A83.1 Bone marrow 3.81E-01 4.51E-02 3.48E-01
Multiple myeloma 2A83.1 Peripheral blood 3.49E-01 1.31E-01 6.04E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.78E-01 1.57E-02 5.46E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.07E-01 3.21E-02 1.93E-01
Myelofibrosis 2A20.2 Whole blood 2.57E-01 -1.65E-02 -1.01E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.48E-01 3.21E-02 5.29E-02
Myopathy 8C70.6 Muscle tissue 7.07E-01 -4.39E-02 -4.18E-01
Neonatal sepsis KA60 Whole blood 7.56E-01 -3.43E-02 -1.68E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.28E-02 -2.83E-01 -5.93E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.92E-01 -5.69E-02 -5.01E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.40E-01 2.51E-02 2.12E-01
Olive pollen allergy CA08.00 Peripheral blood 1.81E-01 -9.33E-02 -7.10E-01
Oral cancer 2B6E Oral tissue 8.77E-01 -1.48E-01 -4.66E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.17E-01 7.33E-02 2.60E-01
Osteoporosis FB83.1 Bone marrow 4.31E-02 2.18E-01 8.81E-01
Ovarian cancer 2C73 Ovarian tissue 5.80E-01 -1.12E-01 -5.10E-01
Pancreatic cancer 2C10 Pancreas 2.50E-01 -2.57E-01 -7.05E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.87E-01 2.92E-02 2.38E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.07E-01 -1.94E-02 -1.47E-01
Pituitary cancer 2D12 Pituitary tissue 7.87E-01 6.94E-02 1.74E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.11E-01 1.32E-01 5.30E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.01E-01 1.24E-01 7.75E-01
Polycythemia vera 2A20.4 Whole blood 3.03E-01 -4.15E-02 -2.56E-01
Pompe disease 5C51.3 Biceps muscle 1.06E-02 -1.44E-01 -8.49E-01
Preterm birth KA21.4Z Myometrium 4.26E-01 3.02E-02 1.66E-01
Prostate cancer 2C82 Prostate 7.96E-01 2.78E-02 5.02E-02
Psoriasis EA90 Skin 4.48E-04 -1.33E-01 -4.21E-01
Rectal cancer 2B92 Rectal colon tissue 9.76E-02 -2.47E-01 -9.91E-01
Renal cancer 2C90-2C91 Kidney 7.54E-01 -2.70E-02 -8.06E-02
Retinoblastoma 2D02.2 Uvea 1.36E-01 3.85E-02 2.65E-01
Rheumatoid arthritis FA20 Synovial tissue 3.24E-01 -2.54E-02 -6.61E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.89E-01 -6.15E-03 -3.68E-02
Schizophrenia 6A20 Prefrontal cortex 7.26E-01 -2.46E-03 -9.40E-03
Schizophrenia 6A20 Superior temporal cortex 5.86E-01 -4.45E-02 -4.54E-01
Scleroderma 4A42.Z Whole blood 3.01E-02 1.65E-01 9.00E-01
Seizure 8A60-8A6Z Whole blood 2.39E-01 -1.50E-01 -9.45E-01
Sensitive skin EK0Z Skin 8.23E-01 -1.85E-03 -1.37E-02
Sepsis with septic shock 1G41 Whole blood 4.64E-03 9.76E-02 3.97E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.02E-01 1.82E-01 6.33E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.11E-04 1.77E-01 2.20E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.22E-01 2.33E-01 1.54E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.19E-01 -1.42E-01 -1.09E+00
Skin cancer 2C30-2C3Z Skin 7.45E-02 -9.70E-02 -2.72E-01
Thrombocythemia 3B63 Whole blood 4.52E-01 -1.87E-02 -1.22E-01
Thrombocytopenia 3B64 Whole blood 9.61E-01 -3.36E-02 -1.26E-01
Thyroid cancer 2D10 Thyroid 7.86E-03 -9.94E-02 -3.78E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.07E-03 -9.69E-02 -5.54E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.82E-01 8.70E-02 9.70E-01
Type 2 diabetes 5A11 Liver tissue 6.56E-01 -1.26E-02 -4.54E-02
Ureter cancer 2C92 Urothelium 6.27E-01 -8.01E-02 -4.67E-01
Uterine cancer 2C78 Endometrium tissue 1.30E-05 -1.58E-01 -6.50E-01
Vitiligo ED63.0 Skin 5.87E-01 8.35E-04 5.06E-03
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Asymmetric dimethylarginine is transported by the mitochondrial carrier SLC25A2. Amino Acids. 2016 Feb;48(2):427-36.