Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTE8R17)

DTP Name Sodium- and chloride-dependent glycine transporter 2 (SLC6A5)
Gene Name SLC6A5
UniProt ID
Q9Y345 (SC6A5_HUMAN)
VARIDT ID
DTD0457
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms GlyT-2; GlyT2; HKPX3; SLC6A5; Solute carrier family 6 member 5
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Expressed in medulla, and to a lesser extentin spinal cord and cerebellum.
Sequence
MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQ
TFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHC
KIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLATDGITSVLPGSVATVATQ
EDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALA
GLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFA
SFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFT
SQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGK
VVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSA
AWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVAD
QGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT
HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQR
FCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWL
MLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGPFLAQHRGERYKNMIDPLGTS
SLGLKLPVKDLELGTQC
Function
This transporter terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals and may be responsible for the termination of neurotransmission at strychnine-sensitive glycinergic synapses.
Endogenous Substrate(s) Cl-; Na+
TCDB ID
2.A.22.2.10
Gene ID
9152
KEGG Pathway
( )
Reactome Pathway
Defective SLC6A5 causes hyperekplexia 3 (HKPX3) (R-HSA-5619089 )
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
3 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glycine DMIOZ29 Malnutrition 5B50-5B71 Approved [2]
Methylphenidate DM7SJD6 Attention deficit hyperactivity disorder 6A05.Z Approved [3]
Norepinephrine DMOUC09 Sepsis 1G40-1G41 Approved [4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.76E-01 2.77E-02 1.85E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.96E-01 -5.59E-02 -4.20E-01
Alopecia ED70 Skin from scalp 2.06E-01 -4.16E-03 -2.95E-02
Alzheimer's disease 8A20 Entorhinal cortex 6.41E-01 -6.40E-03 -4.07E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.74E-01 1.72E-02 1.29E-01
Aortic stenosis BB70 Calcified aortic valve 9.71E-01 -5.81E-02 -8.71E-02
Apnea 7A40 Hyperplastic tonsil 3.42E-01 9.73E-02 7.80E-01
Arthropathy FA00-FA5Z Peripheral blood 1.72E-01 4.93E-02 4.04E-01
Asthma CA23 Nasal and bronchial airway 1.61E-02 -1.04E-01 -2.96E-01
Atopic dermatitis EA80 Skin 1.86E-02 4.56E-02 5.55E-01
Autism 6A02 Whole blood 2.30E-01 -2.63E-02 -1.82E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.09E-02 -2.20E-01 -1.43E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.03E-01 1.23E-02 1.34E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.04E-02 5.06E-02 2.32E-01
Batten disease 5C56.1 Whole blood 7.89E-01 -1.82E-02 -1.29E-01
Behcet's disease 4A62 Peripheral blood 5.50E-01 3.81E-02 3.63E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.86E-01 -8.34E-02 -4.69E-01
Bladder cancer 2C94 Bladder tissue 9.55E-04 5.11E-01 2.17E+00
Breast cancer 2C60-2C6Z Breast tissue 6.69E-13 -9.68E-02 -4.12E-01
Cardioembolic stroke 8B11.20 Whole blood 4.59E-03 8.54E-02 6.42E-01
Cervical cancer 2C77 Cervical tissue 5.16E-01 -5.78E-02 -2.16E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.66E-01 -1.68E-02 -7.68E-02
Chronic hepatitis C 1E51.1 Whole blood 3.24E-01 7.12E-02 6.01E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.41E-02 4.05E-02 2.70E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.81E-06 1.14E-01 7.29E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.66E-01 9.08E-02 1.14E+00
Colon cancer 2B90 Colon tissue 3.81E-06 -6.57E-02 -3.06E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.72E-01 -3.62E-02 -5.37E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.48E-02 -1.92E-01 -8.17E-01
Endometriosis GA10 Endometrium tissue 6.25E-02 1.46E-01 7.34E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.10E-01 1.78E-02 1.35E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.16E-04 1.21E-01 8.53E-01
Gastric cancer 2B72 Gastric tissue 7.72E-01 -4.90E-02 -3.42E-01
Glioblastopma 2A00.00 Nervous tissue 6.20E-03 -2.77E-02 -9.12E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.37E-04 -4.87E-01 -1.53E+00
Head and neck cancer 2D42 Head and neck tissue 9.11E-01 -1.85E-02 -1.03E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.58E-01 -5.48E-02 -2.34E-01
Huntington's disease 8A01.10 Whole blood 6.29E-01 -6.92E-02 -5.09E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.37E-02 -2.12E-01 -1.84E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.11E-01 8.57E-02 8.13E-01
Influenza 1.00E+30 Whole blood 3.92E-02 3.73E-01 1.79E+00
Interstitial cystitis GC00.3 Bladder tissue 8.69E-02 6.68E-02 8.67E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.39E-01 -2.62E-02 -1.62E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.83E-01 1.63E-01 4.10E-01
Ischemic stroke 8B11 Peripheral blood 6.75E-01 2.95E-02 2.87E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.46E-03 9.73E-02 4.25E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.21E-01 -1.22E-01 -2.59E-01
Lateral sclerosis 8B60.4 Skin 4.13E-01 1.89E-02 2.20E-01
Liver cancer 2C12.0 Liver tissue 5.63E-09 -1.85E-01 -1.22E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.61E-01 -2.96E-02 -2.01E-01
Lung cancer 2C25 Lung tissue 6.52E-01 8.47E-03 4.83E-02
Lupus erythematosus 4A40 Whole blood 8.04E-01 -4.17E-02 -1.12E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.92E-01 4.30E-02 2.04E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.96E-01 -2.46E-02 -1.41E-01
Melanoma 2C30 Skin 6.58E-01 1.75E-01 2.82E-01
Multiple myeloma 2A83.1 Bone marrow 3.86E-02 -1.95E-01 -9.68E-01
Multiple myeloma 2A83.1 Peripheral blood 7.83E-02 6.84E-02 4.34E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.41E-02 9.49E-02 7.71E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.06E-01 -5.55E-02 -2.44E-01
Myelofibrosis 2A20.2 Whole blood 1.98E-04 1.10E-01 1.20E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.91E-02 1.85E-01 5.93E-01
Myopathy 8C70.6 Muscle tissue 1.25E-02 -1.73E-01 -1.39E+00
Neonatal sepsis KA60 Whole blood 2.57E-02 6.37E-02 3.40E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.85E-06 -1.38E+00 -2.79E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.30E-01 1.82E-02 1.09E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.64E-02 8.25E-02 1.81E+00
Olive pollen allergy CA08.00 Peripheral blood 3.77E-02 1.41E-01 9.53E-01
Oral cancer 2B6E Oral tissue 5.37E-05 -2.72E-01 -1.27E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.50E-01 -8.80E-02 -5.20E-01
Osteoporosis FB83.1 Bone marrow 9.43E-02 1.03E-01 1.31E+00
Ovarian cancer 2C73 Ovarian tissue 2.31E-02 -3.08E-01 -8.88E-01
Pancreatic cancer 2C10 Pancreas 2.19E-03 -1.88E-01 -1.28E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.44E-01 -6.94E-02 -3.09E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.90E-01 -4.36E-02 -3.08E-01
Pituitary cancer 2D12 Pituitary tissue 6.78E-04 5.48E-01 1.42E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.44E-04 8.11E-01 1.99E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.12E-01 -3.17E-02 -3.78E-01
Polycythemia vera 2A20.4 Whole blood 2.76E-09 1.42E-01 1.36E+00
Pompe disease 5C51.3 Biceps muscle 3.48E-02 -9.88E-02 -9.44E-01
Preterm birth KA21.4Z Myometrium 4.48E-01 -1.88E-02 -2.50E-01
Prostate cancer 2C82 Prostate 7.02E-02 -3.41E-01 -7.52E-01
Psoriasis EA90 Skin 7.14E-08 -1.15E-01 -3.90E-01
Rectal cancer 2B92 Rectal colon tissue 5.45E-01 1.35E-02 1.17E-01
Renal cancer 2C90-2C91 Kidney 3.66E-02 -2.13E-01 -7.76E-01
Retinoblastoma 2D02.2 Uvea 5.25E-01 -6.84E-02 -8.57E-01
Rheumatoid arthritis FA20 Synovial tissue 3.51E-01 -1.91E-01 -5.97E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.21E-01 -1.57E-02 -1.42E-01
Schizophrenia 6A20 Prefrontal cortex 8.70E-01 1.64E-02 8.80E-02
Schizophrenia 6A20 Superior temporal cortex 8.76E-01 -1.33E-02 -9.49E-02
Scleroderma 4A42.Z Whole blood 9.72E-01 1.25E-02 6.36E-02
Seizure 8A60-8A6Z Whole blood 2.68E-01 -1.14E-01 -6.12E-01
Sensitive skin EK0Z Skin 3.52E-01 1.20E-02 7.45E-02
Sepsis with septic shock 1G41 Whole blood 8.92E-02 1.49E-02 7.89E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.25E-01 4.86E-02 2.57E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.06E-01 6.67E-02 2.68E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.65E-02 1.40E-01 5.05E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.57E-01 -1.36E-01 -7.50E-01
Skin cancer 2C30-2C3Z Skin 6.73E-02 -1.17E-01 -3.25E-01
Thrombocythemia 3B63 Whole blood 2.08E-04 2.06E-01 1.99E+00
Thrombocytopenia 3B64 Whole blood 2.23E-01 2.11E-02 1.24E-01
Thyroid cancer 2D10 Thyroid 9.06E-01 -1.31E-02 -7.43E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.95E-02 -1.37E-01 -7.86E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.02E-01 6.76E-02 3.08E+00
Type 2 diabetes 5A11 Liver tissue 4.33E-01 -7.44E-02 -6.59E-01
Ureter cancer 2C92 Urothelium 6.46E-01 -2.95E-03 -1.21E-02
Uterine cancer 2C78 Endometrium tissue 2.19E-02 -6.28E-02 -2.53E-01
Vitiligo ED63.0 Skin 4.16E-03 -2.03E-01 -1.69E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Glycine transporter-2 (SLC6A5) DTT Info
DTP DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Alx 1393 DMP26K9 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 936).
2 Mutations in the GlyT2 gene (SLC6A5) are a second major cause of startle disease. J Biol Chem. 2012 Aug 17;287(34):28975-85.
3 SLC6 transporters: structure, function, regulation, disease association and therapeutics. Mol Aspects Med. 2013 Apr-Jun;34(2-3):197-219.
4 SLC6A2 Gene (Protein Coding).