Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTEOAND)

DTP Name Zinc transporter ZIP11 (SLC39A11)
Gene Name SLC39A11
UniProt ID
Q8N1S5 (S39AB_HUMAN)
VARIDT ID
DTD0339
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms C17orf26; SLC39A11; Solute carrier family 39 member 11; ZIP-11; ZIP11; Zinc transporter ZIP11
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Sequence
MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLL
APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTL
MKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSR
GNLAQPGGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIGIGIQ
NFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFGAFAVVLAEPILPYALAFAAG
AMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG
Function This transporter mediates the transport of cellular zinc.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.5.2
Gene ID
201266
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.10E-02 -7.88E-02 -1.15E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.74E-02 8.19E-02 2.13E-01
Alopecia ED70 Skin from scalp 5.07E-01 -1.44E-02 -8.48E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.22E-05 2.02E-01 5.64E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.69E-01 9.92E-03 6.09E-02
Aortic stenosis BB70 Calcified aortic valve 6.25E-01 5.19E-03 1.63E-02
Apnea 7A40 Hyperplastic tonsil 8.57E-01 5.17E-01 1.28E+00
Arthropathy FA00-FA5Z Peripheral blood 9.55E-01 -2.66E-04 -6.99E-04
Asthma CA23 Nasal and bronchial airway 1.30E-07 5.86E-01 8.46E-01
Atopic dermatitis EA80 Skin 1.04E-04 2.51E-01 1.37E+00
Autism 6A02 Whole blood 1.13E-01 1.98E-01 5.88E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.24E-01 -2.07E-02 -5.82E-02
Autosomal dominant monocytopenia 4B04 Whole blood 1.86E-01 5.78E-01 1.22E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.01E-01 -1.39E-01 -3.59E-01
Batten disease 5C56.1 Whole blood 3.37E-01 3.71E-02 1.35E-01
Behcet's disease 4A62 Peripheral blood 9.33E-01 -1.49E-01 -5.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.38E-01 4.07E-02 1.66E-01
Bladder cancer 2C94 Bladder tissue 2.92E-04 7.63E-01 2.07E+00
Breast cancer 2C60-2C6Z Breast tissue 5.89E-112 1.15E+00 2.25E+00
Cardioembolic stroke 8B11.20 Whole blood 3.54E-01 -6.50E-02 -3.02E-01
Cervical cancer 2C77 Cervical tissue 9.28E-06 -5.63E-01 -1.33E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.84E-01 -4.06E-03 -7.09E-03
Chronic hepatitis C 1E51.1 Whole blood 3.59E-02 -2.57E-01 -1.18E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 4.38E-01 7.91E-02 2.74E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.13E-01 1.34E-01 4.12E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.64E-01 -4.45E-02 -1.13E-01
Colon cancer 2B90 Colon tissue 2.09E-01 4.91E-02 1.32E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.99E-02 2.83E-01 1.31E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.84E-01 3.66E-01 5.54E-01
Endometriosis GA10 Endometrium tissue 1.41E-01 -2.48E-01 -5.80E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.03E-01 -3.75E-02 -1.25E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.23E-13 1.19E+00 1.93E+00
Gastric cancer 2B72 Gastric tissue 7.89E-01 -1.03E-01 -6.20E-02
Glioblastopma 2A00.00 Nervous tissue 4.98E-07 1.57E-01 3.21E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.43E-01 1.85E-01 1.99E-01
Head and neck cancer 2D42 Head and neck tissue 5.14E-17 -6.01E-01 -1.48E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.18E-01 9.53E-02 2.07E-01
Huntington's disease 8A01.10 Whole blood 3.24E-01 -3.53E-01 -9.20E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.47E-03 5.67E-01 2.36E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.93E-01 1.41E-01 7.23E-01
Influenza 1.00E+30 Whole blood 8.65E-01 8.52E-02 2.77E-01
Interstitial cystitis GC00.3 Bladder tissue 6.68E-03 -6.44E-01 -2.02E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.46E-03 8.49E-01 3.53E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.65E-01 5.64E-03 3.55E-02
Ischemic stroke 8B11 Peripheral blood 1.34E-01 -1.39E-01 -4.13E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.42E-01 1.08E-01 2.62E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.44E-01 -1.78E-02 -7.34E-02
Lateral sclerosis 8B60.4 Skin 1.09E-02 3.49E-01 2.31E+00
Liver cancer 2C12.0 Liver tissue 2.08E-01 -6.62E-02 -1.42E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.74E-03 -5.84E-01 -2.13E+00
Lung cancer 2C25 Lung tissue 3.50E-75 9.73E-01 2.35E+00
Lupus erythematosus 4A40 Whole blood 2.41E-06 6.80E-01 5.69E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.85E-02 1.58E-01 6.08E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.93E-01 6.72E-03 2.66E-02
Melanoma 2C30 Skin 2.97E-01 -2.35E-01 -1.87E-01
Multiple myeloma 2A83.1 Bone marrow 1.68E-04 1.64E-01 1.62E+00
Multiple myeloma 2A83.1 Peripheral blood 2.87E-01 1.24E-01 3.78E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.02E-01 -5.34E-01 -9.71E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.45E-02 4.73E-01 7.78E-01
Myelofibrosis 2A20.2 Whole blood 5.59E-02 1.26E-01 8.07E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.98E-03 -9.53E-01 -1.15E+00
Myopathy 8C70.6 Muscle tissue 4.14E-03 4.98E-01 1.72E+00
Neonatal sepsis KA60 Whole blood 2.11E-17 4.32E-01 1.49E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.40E-01 -1.86E-01 -5.06E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.74E-01 -4.85E-02 -2.69E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.30E-01 2.96E-01 7.79E-01
Olive pollen allergy CA08.00 Peripheral blood 6.62E-01 8.15E-02 1.59E-01
Oral cancer 2B6E Oral tissue 1.53E-01 2.83E-03 5.10E-03
Osteoarthritis FA00-FA0Z Synovial tissue 1.02E-01 7.20E-01 7.79E-01
Osteoporosis FB83.1 Bone marrow 7.33E-01 -2.24E-01 -6.97E-01
Ovarian cancer 2C73 Ovarian tissue 4.45E-06 2.08E+00 3.75E+00
Pancreatic cancer 2C10 Pancreas 6.91E-05 7.15E-01 1.54E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.01E-04 4.97E-01 1.75E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.63E-06 5.12E-01 2.46E+00
Pituitary cancer 2D12 Pituitary tissue 8.23E-02 4.08E-01 9.59E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.66E-01 -1.86E-01 -4.37E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.16E-01 7.95E-02 4.56E-01
Polycythemia vera 2A20.4 Whole blood 3.05E-01 1.08E-01 5.29E-01
Pompe disease 5C51.3 Biceps muscle 2.16E-01 5.74E-01 1.12E+00
Preterm birth KA21.4Z Myometrium 6.34E-01 -1.46E-02 -9.21E-02
Prostate cancer 2C82 Prostate 2.11E-04 1.87E+00 1.74E+00
Psoriasis EA90 Skin 1.89E-17 2.73E-01 5.52E-01
Rectal cancer 2B92 Rectal colon tissue 3.24E-02 -3.64E-01 -9.04E-01
Renal cancer 2C90-2C91 Kidney 1.26E-01 2.30E-01 5.34E-01
Retinoblastoma 2D02.2 Uvea 5.83E-11 2.07E+00 5.27E+00
Rheumatoid arthritis FA20 Synovial tissue 1.95E-04 1.30E+00 3.17E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.32E-01 6.57E-05 2.78E-04
Schizophrenia 6A20 Prefrontal cortex 1.95E-01 1.29E-01 2.74E-01
Schizophrenia 6A20 Superior temporal cortex 2.05E-01 3.53E-02 1.35E-01
Scleroderma 4A42.Z Whole blood 1.53E-01 2.15E-02 1.07E-01
Seizure 8A60-8A6Z Whole blood 4.27E-01 1.27E-01 3.69E-01
Sensitive skin EK0Z Skin 1.65E-01 -1.07E-01 -4.10E-01
Sepsis with septic shock 1G41 Whole blood 4.27E-15 1.96E-01 7.00E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.13E-01 -2.22E-01 -6.04E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.85E-02 -1.13E-01 -2.73E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.11E-01 -1.69E-01 -2.78E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.47E-02 -2.84E-01 -9.28E-01
Skin cancer 2C30-2C3Z Skin 4.27E-03 3.43E-01 4.12E-01
Thrombocythemia 3B63 Whole blood 7.85E-01 1.63E-02 1.02E-01
Thrombocytopenia 3B64 Whole blood 2.42E-01 -3.64E-01 -8.94E-01
Thyroid cancer 2D10 Thyroid 3.02E-08 -3.80E-01 -9.44E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.49E-02 2.18E-01 5.29E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.89E-02 5.07E-01 1.89E+00
Type 2 diabetes 5A11 Liver tissue 5.48E-01 4.25E-02 1.04E-01
Ureter cancer 2C92 Urothelium 8.63E-01 3.67E-02 1.09E-01
Uterine cancer 2C78 Endometrium tissue 6.44E-02 -2.37E-01 -3.49E-01
Vitiligo ED63.0 Skin 2.77E-01 -1.58E-01 -5.17E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Gastric and colonic zinc transporter ZIP11 (Slc39a11) in mice responds to dietary zinc and exhibits nuclear localization. J Nutr. 2013 Dec;143(12):1882-8.