Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTFD4VB)

DTP Name Sodium-dependent phosphate transporter 2 (SLC20A2)
Gene Name SLC20A2
UniProt ID
Q08357 (S20A2_HUMAN)
VARIDT ID
DTD0137
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms GLVR-2; GLVR2; Gibbon ape leukemia virus receptor 2; IBGC1; IBGC3; MLVAR; Phosphate transporter 2; PiT-2; Pit2; RAM1; Ram-1; SLC20A2; Solute carrier family 20 member 2; hPit2
DTP Family Inorganic Phosphate Transporter (PIT) Family ;
Tissue Specificity Ubiquitously expressed.
Sequence
MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV
LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG
STIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGL
RALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRR
KITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG
TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHK
IHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT
VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDA
PEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYG
GVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG
SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV
Function
This sodium-phosphate transporter mediates phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants.
Endogenous Substrate(s) Na+
TCDB ID
2.A.20.2.3
Gene ID
6575
Reactome Pathway
Defective SLC20A2 causes idiopathic basal ganglia calcification 1 (IBGC1) (R-HSA-5619111 )
Sodium-coupled phosphate cotransporters (R-HSA-427652 )
BioCyc Pathway
MetaCyc:ENSG00000168575-MON

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phosphate DMUXQG7 Constipation DD91.1 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.04E-04 8.23E-02 3.54E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.97E-02 5.57E-02 1.37E-01
Alopecia ED70 Skin from scalp 8.90E-09 -4.11E-01 -1.31E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.24E-01 -7.26E-02 -2.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.91E-01 2.59E-01 1.42E+00
Aortic stenosis BB70 Calcified aortic valve 7.15E-01 2.32E-03 3.26E-03
Apnea 7A40 Hyperplastic tonsil 3.58E-01 -5.68E-01 -1.10E+00
Arthropathy FA00-FA5Z Peripheral blood 1.28E-01 -1.08E-01 -4.62E-01
Asthma CA23 Nasal and bronchial airway 6.53E-01 6.39E-02 1.78E-01
Atopic dermatitis EA80 Skin 1.31E-01 -1.94E-01 -5.28E-01
Autism 6A02 Whole blood 9.11E-01 -3.84E-02 -1.43E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.11E-01 -2.91E-01 -1.25E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.05E-01 -1.39E-01 -7.29E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.76E-02 -9.38E-02 -2.65E-01
Batten disease 5C56.1 Whole blood 8.04E-01 -1.14E-01 -5.49E-01
Behcet's disease 4A62 Peripheral blood 3.82E-01 7.55E-02 2.54E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.98E-01 -3.79E-02 -1.93E-01
Bladder cancer 2C94 Bladder tissue 9.82E-03 -4.60E-01 -1.94E+00
Breast cancer 2C60-2C6Z Breast tissue 1.40E-13 1.85E-01 4.24E-01
Cardioembolic stroke 8B11.20 Whole blood 1.79E-08 -4.50E-01 -1.60E+00
Cervical cancer 2C77 Cervical tissue 2.55E-01 -1.41E-02 -4.88E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.33E-01 3.36E-02 1.80E-01
Chronic hepatitis C 1E51.1 Whole blood 6.84E-01 -6.46E-03 -2.73E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 3.54E-01 1.14E-01 3.74E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.21E-03 -2.53E-01 -5.93E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.00E-02 -7.03E-01 -1.76E+00
Colon cancer 2B90 Colon tissue 9.54E-51 -9.78E-01 -1.84E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.06E-01 3.89E-02 1.56E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.33E-01 -8.57E-02 -3.18E-01
Endometriosis GA10 Endometrium tissue 1.12E-01 -1.25E-01 -2.44E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.91E-02 -2.03E-01 -1.68E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.89E-01 4.58E-02 1.85E-01
Gastric cancer 2B72 Gastric tissue 3.50E-01 2.49E-01 3.06E-01
Glioblastopma 2A00.00 Nervous tissue 3.32E-12 1.89E-01 4.50E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.62E-05 -8.25E-01 -1.81E+00
Head and neck cancer 2D42 Head and neck tissue 1.35E-03 -3.81E-01 -6.40E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.91E-01 -9.11E-03 -2.54E-02
Huntington's disease 8A01.10 Whole blood 8.43E-01 0.00E+00 0.00E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.97E-01 2.05E-01 4.85E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.73E-01 4.73E-02 2.46E-01
Influenza 1.00E+30 Whole blood 4.21E-02 -9.13E-01 -2.77E+00
Interstitial cystitis GC00.3 Bladder tissue 3.15E-06 -8.46E-01 -1.05E+01
Intracranial aneurysm 8B01.0 Intracranial artery 7.76E-01 -1.25E-01 -3.23E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.68E-03 2.09E-01 5.57E-01
Ischemic stroke 8B11 Peripheral blood 1.57E-01 7.68E-02 4.64E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.46E-02 -2.31E-02 -7.63E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.39E-01 -4.24E-01 -9.56E-01
Lateral sclerosis 8B60.4 Skin 2.21E-01 2.07E-01 9.20E-01
Liver cancer 2C12.0 Liver tissue 2.69E-03 -5.68E-01 -8.38E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.60E-02 -3.18E-01 -5.07E-01
Lung cancer 2C25 Lung tissue 2.15E-01 -1.79E-01 -4.36E-01
Lupus erythematosus 4A40 Whole blood 7.64E-01 1.36E-03 2.45E-03
Major depressive disorder 6A70-6A7Z Whole blood 5.57E-01 -9.90E-03 -3.57E-02
Major depressive disorder 6A70-6A7Z Hippocampus 3.64E-01 7.13E-02 3.60E-01
Melanoma 2C30 Skin 1.34E-01 -2.73E-01 -5.07E-01
Multiple myeloma 2A83.1 Bone marrow 4.03E-01 -1.53E-03 -7.64E-03
Multiple myeloma 2A83.1 Peripheral blood 5.75E-01 -5.22E-02 -2.05E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.84E-01 1.04E-02 3.01E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.29E-03 -1.28E-01 -4.10E-01
Myelofibrosis 2A20.2 Whole blood 5.83E-01 7.81E-02 4.21E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.74E-01 -6.23E-02 -9.46E-02
Myopathy 8C70.6 Muscle tissue 8.62E-02 -3.01E-01 -1.16E+00
Neonatal sepsis KA60 Whole blood 4.04E-05 -1.88E-01 -5.67E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.82E-02 -2.97E-01 -5.95E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.13E-01 2.52E-01 2.02E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.26E-01 3.88E-02 1.41E-01
Olive pollen allergy CA08.00 Peripheral blood 1.52E-01 2.52E-01 7.89E-01
Oral cancer 2B6E Oral tissue 4.45E-01 2.25E-01 3.22E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.47E-01 -4.19E-01 -3.50E-01
Osteoporosis FB83.1 Bone marrow 8.30E-01 7.61E-03 2.08E-02
Ovarian cancer 2C73 Ovarian tissue 3.48E-02 7.91E-01 1.03E+00
Pancreatic cancer 2C10 Pancreas 1.10E-01 5.25E-01 9.12E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.84E-01 6.66E-03 2.13E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.82E-01 -3.59E-02 -1.52E-01
Pituitary cancer 2D12 Pituitary tissue 8.71E-02 -1.69E-02 -4.90E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.15E-01 -1.13E-01 -3.03E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.36E-01 1.40E-02 4.93E-02
Polycythemia vera 2A20.4 Whole blood 1.47E-06 -7.75E-02 -4.39E-01
Pompe disease 5C51.3 Biceps muscle 7.12E-01 7.30E-03 2.14E-02
Preterm birth KA21.4Z Myometrium 2.85E-02 3.44E-01 9.81E-01
Prostate cancer 2C82 Prostate 5.41E-02 6.46E-01 8.28E-01
Psoriasis EA90 Skin 1.75E-10 3.62E-01 9.13E-01
Rectal cancer 2B92 Rectal colon tissue 6.56E-02 -1.25E-01 -6.40E-01
Renal cancer 2C90-2C91 Kidney 2.41E-02 -4.01E-01 -8.82E-01
Retinoblastoma 2D02.2 Uvea 1.59E-02 3.30E-01 1.03E+00
Rheumatoid arthritis FA20 Synovial tissue 2.59E-01 1.01E+00 1.01E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.64E-01 3.81E-02 1.85E-01
Schizophrenia 6A20 Prefrontal cortex 4.15E-02 -2.04E-01 -3.85E-01
Schizophrenia 6A20 Superior temporal cortex 3.90E-02 -1.91E-01 -1.20E+00
Scleroderma 4A42.Z Whole blood 1.42E-02 -2.08E-01 -7.86E-01
Seizure 8A60-8A6Z Whole blood 7.48E-01 -2.05E-02 -8.28E-02
Sensitive skin EK0Z Skin 6.02E-01 -1.20E-02 -1.16E-01
Sepsis with septic shock 1G41 Whole blood 1.88E-05 -1.62E-01 -4.75E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.81E-02 2.16E-01 2.09E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.89E-01 2.12E-03 1.16E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 7.87E-01 4.11E-02 2.66E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.42E-01 -1.90E-01 -7.06E-01
Skin cancer 2C30-2C3Z Skin 9.37E-02 1.72E-01 3.67E-01
Thrombocythemia 3B63 Whole blood 6.85E-03 -6.44E-02 -3.61E-01
Thrombocytopenia 3B64 Whole blood 7.12E-01 1.55E-01 4.15E-01
Thyroid cancer 2D10 Thyroid 3.29E-34 -7.76E-01 -1.70E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.80E-02 -4.15E-01 -8.70E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.26E-01 -3.35E-02 -2.76E-01
Type 2 diabetes 5A11 Liver tissue 7.93E-01 -6.55E-02 -3.54E-01
Ureter cancer 2C92 Urothelium 1.81E-01 -6.28E-02 -4.09E-01
Uterine cancer 2C78 Endometrium tissue 6.82E-01 7.77E-02 1.92E-01
Vitiligo ED63.0 Skin 3.03E-01 -2.99E-02 -1.85E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Phosphate transporters and their function. Annu Rev Physiol. 2013;75:535-50.