General Information of Drug Transporter (DTP) (ID: DTGDWVS)

DTP Name Voltage-gated potassium channel subunit Kv1.5 (KCNA5)
Gene Name KCNA5
UniProt ID
P22460 (KCNA5_HUMAN)
VARIDT ID
DTD0544
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms HPCN1; Voltage-gated potassium channel HK2; Potassium voltage-gated channel subfamily A member 5
DTP Family Voltage-gated Ion Channel (VIC) Superfamily ;
Tissue Specificity Pancreatic islets and insulinoma.
Sequence
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQ
RVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQ
SGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIF
EYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANG
SGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNII
DVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTT
VGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQG
TQSQGPGLDRGVQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSL
YALCLDTSRETDL
Function
This transporter is voltage-gated potassium channel, which mediates transmembrane potassium transport in excitable membranes. And forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient.
TCDB ID
1.A.1.2.4
Gene ID
3741
Reactome Pathway
Voltage gated Potassium channels (R-HSA-1296072 )

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Voltage-gated potassium channel Kv1.5 (KCNA5) DTT Info
DTP DTT Type Successful
1 Approved Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dronedarone DMA8FS5 Angina pectoris BA40 Approved [1]
------------------------------------------------------------------------------------
5 Clinical Trial Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
BMS-919373 DMN28WK Atrial fibrillation BC81.3 Phase 2 [2]
BMS-394136 DMGDJQR Arrhythmia BC9Z Phase 1 [3]
IQB-9302 DMET0H4 Pain MG30-MG3Z Phase 1 [4]
XEN-D0101 DMU0V45 Atrial fibrillation BC81.3 Phase 1 [5]
XEN-D0103 DMR0U4V Atrial fibrillation BC81.3 Phase 1 [6]
------------------------------------------------------------------------------------
1 Preclinical Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
T-226296 DMJ6P9U Obesity 5B81 Preclinical [1]
------------------------------------------------------------------------------------
1 Discontinued Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zatebradine DMNYKOT Angina pectoris BA40 Terminated [7]
------------------------------------------------------------------------------------
20 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-amino-2-phenyl-1,1-di(pyridin-3-yl)ethanol DM14HCY Discovery agent N.A. Investigative [8]
2-morpholino-1,1,2-triphenylethanol DMFHTEG Discovery agent N.A. Investigative [8]
2-morpholino-1,1-di(pyridin-3-yl)hexan-1-ol DMH89O5 Discovery agent N.A. Investigative [8]
2-morpholino-1,1-di(pyridin-3-yl)octan-1-ol DMDMVA1 Discovery agent N.A. Investigative [8]
2-morpholino-2-phenyl-1,1-di(pyridin-3-yl)ethanol DM3V5AB Discovery agent N.A. Investigative [8]
2-phenoxy-1-(2-p-tolylthiazolidin-3-yl)ethanone DMQX7FW Discovery agent N.A. Investigative [9]
2-phenyl-1,1-di(pyridin-3-yl)ethanol DMERNSK Discovery agent N.A. Investigative [8]
3-(4-methoxybenzyloxy)-2-phenylthiazolidin-4-one DMFRZGS Discovery agent N.A. Investigative [9]
3-(benzyloxy)-2-(4-chlorophenyl)thiazolidin-4-one DMD4WHN Discovery agent N.A. Investigative [9]
3-methyl-2-morpholino-1,1-diphenylbutan-1-ol DMKWAV6 Discovery agent N.A. Investigative [8]
4-(4-phenoxybutoxy)-7H-furo[3,2-g]chromen-7-one DMKMH5L Discovery agent N.A. Investigative [10]
clofilium DMQ37OP Discovery agent N.A. Investigative [11]
DPO-1 DMHCZP0 Atrial fibrillation BC81.3 Investigative [6]
N-Benzyl-2-(toluene-4-sulfonylamino)-benzamide DM3C0P2 Discovery agent N.A. Investigative [12]
N-Phenethyl-2-(toluene-4-sulfonylamino)-benzamide DM1BU5P Discovery agent N.A. Investigative [12]
NIP-142 DMV53PH Atrial fibrillation BC81.3 Investigative [1]
RS-100302 DM63NGW Atrial fibrillation BC81.3 Investigative [1]
S-9947 DMHB6UY Atrial fibrillation BC81.3 Investigative [1]
XEN-D0104 DM1EHG5 Atrial fibrillation BC81.3 Investigative [6]
[14C]TEA DM6SFYH Discovery agent N.A. Investigative [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Investigative Drug(s)

References

1 New antiarrhythmic agents for atrial fibrillation and atrial flutter. Expert Opin Emerg Drugs. 2005 May;10(2):311-22.
2 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035504)
3 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
4 Stereoselective effects of the enantiomers of a new local anaesthetic, IQB-9302, on a human cardiac potassium channel (Kv1.5). Br J Pharmacol. 2001 Jan;132(2):385-92.
5 Human electrophysiological and pharmacological properties of XEN-D0101: a novel atrial-selective Kv1.5/IKur inhibitor. J Cardiovasc Pharmacol. 2013 May;61(5):408-15.
6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 542).
7 DOI: 10.1161/01.CIR.94.3.562
8 Discovery of triarylethanolamine inhibitors of the Kv1.5 potassium channel. Bioorg Med Chem Lett. 2010 Apr 15;20(8):2493-6.
9 Evolution of thiazolidine-based blockers of human Kv1.5 for the treatment of atrial arrhythmias. Bioorg Med Chem Lett. 2007 Jan 1;17(1):282-4.
10 Substituted N-{3-[(1,1-dioxido-1,2-benzothiazol-3-yl)(phenyl)amino]propyl}benzamide analogs as potent Kv1.3 ion channel blockers. Part 2. Bioorg Med Chem Lett. 2010 Dec 1;20(23):6989-92.
11 Mechanism of clofilium block of the human Kv1.5 delayed rectifier potassium channel. Mol Pharmacol. 1995 Jan;47(1):198-205.
12 Pharmacophore-based search, synthesis, and biological evaluation of anthranilic amides as novel blockers of the Kv1.5 channel. Bioorg Med Chem Lett. 2004 Jun 7;14(11):2823-7.
13 Pharmacological characterization of five cloned voltage-gated K+ channels, types Kv1.1, 1.2, 1.3, 1.5, and 3.1, stably expressed in mammalian cell lines. Mol Pharmacol. 1994 Jun;45(6):1227-34.