Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTGUASD)

DTP Name Sodium-independent chloride/iodide transporter (SLC26A4)
Gene Name SLC26A4
UniProt ID
O43511 (S26A4_HUMAN)
VARIDT ID
DTD0232
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms DFNB4; EVA; PDS; Pendrin; SLC26A4; Solute carrier family 26 member 4; TDH2B
DTP Family Sulfate Permease (SULP) Family ;
Tissue Specificity High expression in adult thyroid, lowerexpression in adult and fetal kidney and fetal brain. Notexpressed in other tissues.
Sequence
MAAPGGRSEPPQLPEYSCSYMVSRPVYSELAFQQQHERRLQERKTLRESLAKCCSCSRKR
AFGVLKTLVPILEWLPKYRVKEWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFLVSSSNGTVLNTTMIDTAA
RDTARVLIASALTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVKELNDRFRHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QVAGIISAAIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQLCDIPRLWRQNKIDAV
IWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIE
EPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRAT
KNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFL
TVHDAILYLQNQVKSQEGQGSILETITLIQDCKDTLELIETELTEEELDVQDEAMRTLAS
Function This transporter is sodium-independent transporter of chloride and iodide.
Endogenous Substrate(s) Cl-; I-; Bicarbonate; Cyanate; Thiocyanate
TCDB ID
2.A.53.2.17
Gene ID
5172
KEGG Pathway
Thyroid hormone synthesis (hsa04918 )
Reactome Pathway
Defective SLC26A4 causes Pendred syndrome (PDS) (R-HSA-5619046 )
Multifunctional anion exchangers (R-HSA-427601 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.39E-01 8.44E-03 6.52E-02
Adrenocortical carcinoma 2D11.Z Kidney 2.77E-01 -1.12E-01 -6.19E-01
Alopecia ED70 Skin from scalp 8.64E-01 -8.76E-02 -8.91E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.81E-01 -9.41E-02 -2.54E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.26E-01 5.78E-02 6.03E-01
Aortic stenosis BB70 Calcified aortic valve 4.10E-01 -5.04E-02 -7.27E-02
Apnea 7A40 Hyperplastic tonsil 8.49E-01 -8.87E-02 -1.24E+00
Arthropathy FA00-FA5Z Peripheral blood 3.41E-01 1.64E-02 1.44E-01
Asthma CA23 Nasal and bronchial airway 1.62E-06 1.91E+00 8.91E-01
Atopic dermatitis EA80 Skin 3.37E-03 2.59E-01 1.20E+00
Autism 6A02 Whole blood 2.85E-01 5.13E-02 4.32E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.38E-01 1.03E-01 8.85E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.99E-01 6.95E-02 4.33E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.07E-03 -7.17E-02 -5.26E-01
Batten disease 5C56.1 Whole blood 9.38E-01 -3.27E-02 -1.54E-01
Behcet's disease 4A62 Peripheral blood 4.32E-01 -3.23E-02 -2.36E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.05E-01 -2.14E-02 -3.69E-02
Bladder cancer 2C94 Bladder tissue 5.31E-01 -1.01E-01 -1.22E+00
Breast cancer 2C60-2C6Z Breast tissue 1.43E-16 -3.11E-01 -5.75E-01
Cardioembolic stroke 8B11.20 Whole blood 9.59E-01 -1.30E-03 -7.31E-03
Cervical cancer 2C77 Cervical tissue 6.18E-01 4.74E-02 3.85E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.20E-02 -7.30E-02 -6.14E-01
Chronic hepatitis C 1E51.1 Whole blood 4.06E-02 6.75E-02 6.46E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.64E-01 -4.09E-02 -1.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.59E-01 -1.04E-01 -8.39E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.74E-02 2.45E+00 6.30E+00
Colon cancer 2B90 Colon tissue 1.22E-04 6.90E-02 3.14E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.33E-01 8.04E-02 1.62E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.04E-01 -4.67E-02 -2.01E-01
Endometriosis GA10 Endometrium tissue 4.26E-03 -1.69E-01 -2.10E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.45E-01 5.25E-02 5.34E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.63E-01 -2.33E-02 -1.93E-01
Gastric cancer 2B72 Gastric tissue 1.60E-01 9.98E-03 6.79E-02
Glioblastopma 2A00.00 Nervous tissue 6.40E-32 -5.06E-01 -7.04E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.64E-01 -1.29E-01 -2.44E-01
Head and neck cancer 2D42 Head and neck tissue 2.49E-02 2.25E-03 1.69E-03
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.55E-01 2.72E-02 4.79E-02
Huntington's disease 8A01.10 Whole blood 4.75E-01 -1.58E-02 -1.29E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.32E-01 3.79E-02 1.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.17E-01 -4.19E-02 -3.98E-01
Influenza 1.00E+30 Whole blood 7.43E-03 3.09E-01 4.36E+00
Interstitial cystitis GC00.3 Bladder tissue 1.88E-01 5.64E-03 1.01E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.51E-01 -1.68E-01 -2.02E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.28E-01 -7.37E-03 -1.97E-02
Ischemic stroke 8B11 Peripheral blood 4.00E-01 -6.40E-02 -3.79E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.77E-02 9.47E-02 3.12E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.19E-02 3.33E-01 1.42E+00
Lateral sclerosis 8B60.4 Skin 7.92E-01 -5.08E-02 -3.66E-01
Liver cancer 2C12.0 Liver tissue 2.04E-01 1.57E-02 8.95E-02
Liver failure DB99.7-DB99.8 Liver tissue 3.75E-02 -6.13E-02 -3.98E-01
Lung cancer 2C25 Lung tissue 4.26E-01 -2.07E-01 -2.28E-01
Lupus erythematosus 4A40 Whole blood 9.98E-01 -3.81E-03 -2.68E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.33E-01 4.03E-02 1.49E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.65E-01 -2.90E-02 -5.23E-02
Melanoma 2C30 Skin 5.34E-03 3.08E-02 4.60E-02
Multiple myeloma 2A83.1 Bone marrow 6.12E-02 4.31E-02 5.34E-01
Multiple myeloma 2A83.1 Peripheral blood 2.40E-01 1.31E-01 5.55E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.79E-01 8.11E-03 2.19E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.81E-01 -9.69E-03 -7.20E-02
Myelofibrosis 2A20.2 Whole blood 2.47E-01 3.26E-03 3.68E-02
Myocardial infarction BA41-BA50 Peripheral blood 4.73E-01 -8.59E-02 -1.51E-01
Myopathy 8C70.6 Muscle tissue 1.89E-01 6.12E-02 1.04E+00
Neonatal sepsis KA60 Whole blood 2.37E-01 4.32E-03 2.88E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.31E-03 3.20E-02 2.06E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.81E-01 -6.68E-03 -8.30E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.20E-01 -2.82E-01 -1.53E+00
Olive pollen allergy CA08.00 Peripheral blood 7.58E-01 1.07E-02 4.63E-02
Oral cancer 2B6E Oral tissue 1.35E-01 8.96E-03 6.76E-02
Osteoarthritis FA00-FA0Z Synovial tissue 5.09E-01 2.69E-02 2.14E-02
Osteoporosis FB83.1 Bone marrow 4.78E-01 -4.61E-02 -1.17E-01
Ovarian cancer 2C73 Ovarian tissue 1.66E-01 -2.49E-01 -6.28E-01
Pancreatic cancer 2C10 Pancreas 3.25E-02 -2.62E-01 -7.35E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.20E-01 -1.10E-01 -1.09E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.08E-01 -3.78E-02 -4.61E-01
Pituitary cancer 2D12 Pituitary tissue 4.00E-01 -1.14E-02 -2.84E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.02E-01 3.02E-01 1.01E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.40E-01 1.95E-02 2.95E-01
Polycythemia vera 2A20.4 Whole blood 2.49E-01 -3.32E-02 -3.52E-01
Pompe disease 5C51.3 Biceps muscle 2.72E-02 2.85E-01 1.36E+00
Preterm birth KA21.4Z Myometrium 9.71E-01 -3.16E-02 -1.80E-01
Prostate cancer 2C82 Prostate 8.29E-01 -2.51E-01 -9.46E-02
Psoriasis EA90 Skin 3.72E-31 6.44E-01 2.01E+00
Rectal cancer 2B92 Rectal colon tissue 8.50E-02 -4.43E-02 -5.05E-01
Renal cancer 2C90-2C91 Kidney 1.41E-01 -3.72E-01 -3.49E-01
Retinoblastoma 2D02.2 Uvea 5.86E-05 4.31E-01 3.69E+00
Rheumatoid arthritis FA20 Synovial tissue 1.32E-02 -4.71E-01 -1.46E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.01E-01 -6.02E-02 -3.89E-02
Schizophrenia 6A20 Prefrontal cortex 1.82E-01 -5.63E-02 -6.36E-02
Schizophrenia 6A20 Superior temporal cortex 8.21E-02 1.54E-01 5.71E-01
Scleroderma 4A42.Z Whole blood 6.04E-01 4.44E-02 3.37E-01
Seizure 8A60-8A6Z Whole blood 4.32E-01 1.38E-02 1.07E-01
Sensitive skin EK0Z Skin 9.06E-01 -6.28E-03 -3.93E-02
Sepsis with septic shock 1G41 Whole blood 3.99E-02 -2.10E-04 -1.41E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.40E-01 -1.03E-01 -5.68E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.29E-01 3.25E-02 2.92E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.71E-01 1.37E-01 1.22E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.32E-01 1.64E-01 6.72E-01
Skin cancer 2C30-2C3Z Skin 7.60E-27 4.02E-01 8.89E-01
Thrombocythemia 3B63 Whole blood 6.86E-01 -1.96E-02 -2.09E-01
Thrombocytopenia 3B64 Whole blood 5.78E-01 -4.35E-02 -3.30E-01
Thyroid cancer 2D10 Thyroid 5.66E-42 -2.20E+00 -2.26E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.23E-03 2.20E-01 1.60E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.99E-01 -5.49E-01 -5.03E+00
Type 2 diabetes 5A11 Liver tissue 9.15E-02 -6.01E-02 -6.57E-01
Ureter cancer 2C92 Urothelium 1.40E-01 -2.14E-01 -6.95E-01
Uterine cancer 2C78 Endometrium tissue 5.33E-04 -1.94E-01 -1.62E-01
Vitiligo ED63.0 Skin 5.88E-01 1.66E-01 3.39E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 26 member 4 (SLC26A4) DTT Info
DTP DTT Type Literature-reported