Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTH08M7)

DTP Name Zinc transporter ZIP3 (SLC39A3)
Gene Name SLC39A3
UniProt ID
Q9BRY0 (S39A3_HUMAN)
VARIDT ID
DTD0344
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC39A3; Solute carrier family 39 member 3; ZIP-3; ZIP3; Zinc transporter ZIP3
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Sequence
MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF
NALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLET
FNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH
SVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMI
PLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLV
LGYTVLAGMVFLKW
Function This transporter mediates the influx of zinc.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.3.3
Gene ID
29985
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Reactome Pathway
Zinc influx into cells by the SLC39 gene family (R-HSA-442380 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.12E-08 1.33E-01 4.11E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.96E-01 -1.60E-01 -5.71E-01
Alopecia ED70 Skin from scalp 4.53E-01 -2.10E-02 -6.55E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.50E-08 -2.16E-01 -1.04E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 1.83E-01 2.27E-03 1.69E-02
Aortic stenosis BB70 Calcified aortic valve 5.85E-01 2.99E-01 4.11E-01
Apnea 7A40 Hyperplastic tonsil 7.26E-01 -7.72E-02 -5.65E-01
Arthropathy FA00-FA5Z Peripheral blood 8.49E-01 -4.02E-02 -2.41E-01
Asthma CA23 Nasal and bronchial airway 5.20E-02 6.32E-02 1.40E-01
Atopic dermatitis EA80 Skin 1.92E-01 -8.26E-02 -5.34E-01
Autism 6A02 Whole blood 6.29E-02 -1.23E-01 -4.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.30E-01 1.74E-02 1.57E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.72E-02 2.08E-01 2.42E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.21E-03 6.91E-02 3.00E-01
Batten disease 5C56.1 Whole blood 9.88E-01 8.15E-02 2.77E-01
Behcet's disease 4A62 Peripheral blood 1.50E-01 -4.65E-02 -2.24E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.63E-01 -6.87E-02 -3.02E-01
Bladder cancer 2C94 Bladder tissue 1.25E-03 4.28E-01 1.91E+00
Breast cancer 2C60-2C6Z Breast tissue 7.09E-15 1.56E-01 4.85E-01
Cardioembolic stroke 8B11.20 Whole blood 7.89E-05 1.85E-01 8.14E-01
Cervical cancer 2C77 Cervical tissue 7.63E-01 1.78E-03 6.65E-03
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.72E-01 3.31E-02 1.82E-01
Chronic hepatitis C 1E51.1 Whole blood 3.74E-01 -2.87E-02 -2.36E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.62E-01 -1.69E-02 -9.05E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.29E-02 7.61E-02 2.51E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.27E-02 2.38E-01 1.19E+00
Colon cancer 2B90 Colon tissue 6.48E-04 -1.05E-01 -4.13E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.63E-02 1.70E-01 1.46E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.69E-01 9.19E-02 3.02E-01
Endometriosis GA10 Endometrium tissue 3.87E-01 1.37E-01 4.08E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.19E-01 4.24E-02 3.09E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.42E-02 2.70E-01 1.32E+00
Gastric cancer 2B72 Gastric tissue 1.38E-01 -4.92E-01 -1.90E+00
Glioblastopma 2A00.00 Nervous tissue 9.79E-92 -4.41E-01 -1.49E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.40E-02 2.63E-01 7.57E-01
Head and neck cancer 2D42 Head and neck tissue 8.97E-01 -1.48E-02 -6.50E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.02E-01 -1.22E-01 -4.73E-01
Huntington's disease 8A01.10 Whole blood 9.87E-01 -6.07E-02 -2.70E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.41E-01 9.35E-02 8.68E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.10E-02 1.16E-01 1.05E+00
Influenza 1.00E+30 Whole blood 6.38E-01 5.98E-02 4.73E-01
Interstitial cystitis GC00.3 Bladder tissue 2.34E-01 4.00E-02 3.28E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.21E-01 1.07E-01 3.64E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.08E-01 2.88E-02 1.14E-01
Ischemic stroke 8B11 Peripheral blood 7.05E-01 -6.84E-02 -5.15E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.74E-01 -6.34E-03 -1.69E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.74E-01 3.29E-01 9.21E-01
Lateral sclerosis 8B60.4 Skin 1.93E-01 3.18E-02 5.21E-01
Liver cancer 2C12.0 Liver tissue 6.52E-01 -6.88E-02 -2.69E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.36E-01 -9.01E-02 -4.23E-01
Lung cancer 2C25 Lung tissue 6.94E-01 -1.15E-02 -4.57E-02
Lupus erythematosus 4A40 Whole blood 2.20E-03 -1.12E-01 -2.84E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.15E-01 -9.53E-02 -3.30E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.77E-01 -8.47E-02 -3.85E-01
Melanoma 2C30 Skin 2.27E-01 1.14E-01 2.64E-01
Multiple myeloma 2A83.1 Bone marrow 1.35E-03 2.87E-01 1.58E+00
Multiple myeloma 2A83.1 Peripheral blood 3.31E-01 -5.58E-02 -4.46E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.07E-01 -2.83E-03 -1.23E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.63E-02 1.13E-01 3.14E-01
Myelofibrosis 2A20.2 Whole blood 6.21E-02 1.27E-01 1.19E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.60E-01 1.74E-01 4.24E-01
Myopathy 8C70.6 Muscle tissue 1.61E-01 -1.33E-01 -7.17E-01
Neonatal sepsis KA60 Whole blood 1.97E-01 2.64E-02 1.01E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.47E-03 -5.04E-01 -1.55E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.87E-01 4.00E-02 1.75E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.45E-02 1.11E-01 1.11E+00
Olive pollen allergy CA08.00 Peripheral blood 4.36E-01 -1.12E-02 -1.69E-01
Oral cancer 2B6E Oral tissue 1.50E-07 -3.26E-01 -1.55E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.38E-01 1.42E-02 5.73E-02
Osteoporosis FB83.1 Bone marrow 9.80E-01 1.04E-01 3.99E-01
Ovarian cancer 2C73 Ovarian tissue 5.57E-01 -1.47E-01 -3.14E-01
Pancreatic cancer 2C10 Pancreas 4.62E-02 -1.92E-01 -6.38E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.37E-01 -2.53E-02 -8.14E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.71E-01 -6.58E-02 -3.61E-01
Pituitary cancer 2D12 Pituitary tissue 9.57E-01 -4.02E-02 -1.83E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.29E-01 -1.21E-01 -4.57E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.15E-01 4.82E-02 2.68E-01
Polycythemia vera 2A20.4 Whole blood 2.50E-01 4.82E-02 5.06E-01
Pompe disease 5C51.3 Biceps muscle 3.73E-01 -7.11E-02 -3.60E-01
Preterm birth KA21.4Z Myometrium 5.64E-01 5.70E-03 1.76E-02
Prostate cancer 2C82 Prostate 1.33E-02 -2.51E-01 -5.73E-01
Psoriasis EA90 Skin 6.76E-01 -7.16E-02 -1.77E-01
Rectal cancer 2B92 Rectal colon tissue 6.44E-01 -4.22E-02 -2.40E-01
Renal cancer 2C90-2C91 Kidney 2.47E-03 -3.48E-01 -1.77E+00
Retinoblastoma 2D02.2 Uvea 3.70E-01 -1.57E-01 -8.82E-01
Rheumatoid arthritis FA20 Synovial tissue 7.64E-01 8.65E-02 3.67E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.93E-01 -2.47E-02 -2.19E-01
Schizophrenia 6A20 Prefrontal cortex 9.00E-01 -1.94E-02 -8.75E-02
Schizophrenia 6A20 Superior temporal cortex 5.57E-01 -1.66E-02 -1.02E-01
Scleroderma 4A42.Z Whole blood 8.07E-01 1.44E-02 1.12E-01
Seizure 8A60-8A6Z Whole blood 3.43E-01 -1.83E-01 -8.75E-01
Sensitive skin EK0Z Skin 4.35E-01 -4.44E-03 -3.71E-02
Sepsis with septic shock 1G41 Whole blood 1.15E-01 6.39E-02 2.87E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.47E-01 -7.52E-02 -2.66E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.39E-02 2.68E-01 1.06E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.06E-01 5.10E-02 1.97E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.12E-01 4.63E-02 1.28E-01
Skin cancer 2C30-2C3Z Skin 2.57E-01 3.03E-02 7.50E-02
Thrombocythemia 3B63 Whole blood 2.99E-01 9.56E-02 9.49E-01
Thrombocytopenia 3B64 Whole blood 5.12E-01 6.19E-01 8.11E-01
Thyroid cancer 2D10 Thyroid 3.79E-06 9.35E-02 4.09E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.14E-03 -3.20E-01 -1.02E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.42E-01 -1.77E-01 -7.42E-01
Type 2 diabetes 5A11 Liver tissue 5.34E-01 -4.84E-02 -1.91E-01
Ureter cancer 2C92 Urothelium 4.21E-01 1.16E-01 5.39E-01
Uterine cancer 2C78 Endometrium tissue 4.98E-04 -1.05E-01 -2.92E-01
Vitiligo ED63.0 Skin 5.22E-01 1.94E-02 5.75E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The SLC39 family of zinc transporters. Mol Aspects Med. 2013 Apr-Jun;34(2-3):612-9.