Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTIAF6C)

DTP Name Zinc transporter 2 (SLC30A2)
Gene Name SLC30A2
UniProt ID
Q9BRI3 (ZNT2_HUMAN)
VARIDT ID
DTD0271
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms PP12488; SLC30A2; Solute carrier family 30 member 2; TNZD; ZNT2; ZnT-2
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Sequence
MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD
SHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISG
DYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFM
QSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTA
VRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHT
VTIQIEDYSEDMKDCQACQGPSD
Function This transporter is a zinc transporter that acts as a homodimer. The encoded protein plays a role in secreting zinc into breast milk.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.3.6
Gene ID
7780
Reactome Pathway
Zinc efflux and compartmentalization by the SLC30 family (R-HSA-435368 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.31E-05 1.25E-01 5.82E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.12E-01 -1.19E-01 -3.07E-01
Alopecia ED70 Skin from scalp 6.03E-01 -8.38E-02 -3.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.86E-01 -3.20E-02 -2.00E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.64E-01 -5.14E-02 -6.27E-01
Aortic stenosis BB70 Calcified aortic valve 7.32E-01 -1.76E-01 -3.06E-01
Apnea 7A40 Hyperplastic tonsil 4.87E-02 -2.55E-01 -1.23E+00
Arthropathy FA00-FA5Z Peripheral blood 2.67E-01 4.49E-02 3.33E-01
Asthma CA23 Nasal and bronchial airway 2.43E-01 -1.13E-03 -3.59E-03
Atopic dermatitis EA80 Skin 1.26E-06 -1.52E-01 -1.29E+00
Autism 6A02 Whole blood 1.32E-01 1.78E-02 8.39E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.42E-02 -1.62E-01 -1.32E+00
Autosomal dominant monocytopenia 4B04 Whole blood 9.46E-01 -3.16E-02 -4.93E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.38E-04 1.16E-01 4.12E-01
Batten disease 5C56.1 Whole blood 2.46E-01 7.34E-02 7.24E-01
Behcet's disease 4A62 Peripheral blood 5.16E-01 -2.38E-02 -1.17E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.67E-01 -3.68E-02 -2.75E-01
Bladder cancer 2C94 Bladder tissue 1.34E-01 -2.94E-03 -1.11E-02
Breast cancer 2C60-2C6Z Breast tissue 4.59E-01 -6.90E-02 -2.80E-01
Cardioembolic stroke 8B11.20 Whole blood 2.11E-01 1.14E-01 5.39E-01
Cervical cancer 2C77 Cervical tissue 2.79E-01 9.85E-02 6.21E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.89E-01 -3.75E-02 -1.28E-01
Chronic hepatitis C 1E51.1 Whole blood 3.81E-02 4.17E-02 3.48E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.42E-02 1.03E-01 4.42E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.66E-03 1.16E-01 5.40E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.89E-01 8.61E-02 5.17E-01
Colon cancer 2B90 Colon tissue 5.19E-08 9.57E-02 3.87E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.41E-01 5.35E-03 1.69E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.72E-01 -7.50E-02 -4.33E-01
Endometriosis GA10 Endometrium tissue 1.29E-01 1.11E-01 9.39E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.46E-01 6.14E-02 3.64E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.61E-01 -2.81E-02 -1.25E-01
Gastric cancer 2B72 Gastric tissue 1.68E-01 -1.93E-01 -1.68E+00
Glioblastopma 2A00.00 Nervous tissue 1.58E-09 -9.83E-02 -3.92E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.02E-04 -4.89E-01 -2.24E+00
Head and neck cancer 2D42 Head and neck tissue 5.47E-01 3.51E-02 1.71E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.75E-02 -1.37E-02 -6.54E-02
Huntington's disease 8A01.10 Whole blood 6.09E-01 9.19E-02 3.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.45E-01 7.10E-02 2.49E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.52E-01 1.73E-02 1.80E-01
Influenza 1.00E+30 Whole blood 3.45E-02 3.91E-01 2.20E+00
Interstitial cystitis GC00.3 Bladder tissue 5.58E-04 -3.24E-01 -2.52E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.59E-01 -8.56E-02 -3.94E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.12E-01 -6.95E-02 -3.49E-01
Ischemic stroke 8B11 Peripheral blood 1.45E-01 3.95E-02 3.37E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.34E-02 6.08E-02 2.42E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.19E-01 -2.12E-02 -1.37E-01
Lateral sclerosis 8B60.4 Skin 4.12E-01 3.02E-02 1.79E-01
Liver cancer 2C12.0 Liver tissue 9.16E-01 -9.13E-02 -5.20E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.43E-02 3.26E-01 1.12E+00
Lung cancer 2C25 Lung tissue 2.21E-01 -1.99E-02 -1.09E-01
Lupus erythematosus 4A40 Whole blood 1.26E-02 -7.32E-02 -1.44E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.31E-01 2.27E-02 1.19E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.69E-01 -3.20E-03 -2.37E-02
Melanoma 2C30 Skin 8.04E-01 2.03E-01 3.99E-01
Multiple myeloma 2A83.1 Bone marrow 7.61E-01 2.82E-02 2.13E-01
Multiple myeloma 2A83.1 Peripheral blood 7.80E-01 4.53E-02 2.85E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.11E-01 9.16E-02 2.55E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.17E-01 3.22E-02 1.88E-01
Myelofibrosis 2A20.2 Whole blood 5.27E-01 -3.52E-03 -2.15E-02
Myocardial infarction BA41-BA50 Peripheral blood 7.49E-02 3.40E-01 7.78E-01
Myopathy 8C70.6 Muscle tissue 4.33E-02 7.17E-02 8.12E-01
Neonatal sepsis KA60 Whole blood 9.54E-01 -1.55E-02 -5.25E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.59E-04 -5.23E-01 -1.58E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.23E-01 -3.61E-03 -2.58E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.50E-01 -6.56E-02 -5.21E-01
Olive pollen allergy CA08.00 Peripheral blood 2.28E-01 2.83E-01 1.05E+00
Oral cancer 2B6E Oral tissue 1.83E-06 -2.56E-01 -9.66E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.56E-01 -9.72E-02 -3.00E-01
Osteoporosis FB83.1 Bone marrow 7.36E-02 9.30E-02 1.20E+00
Ovarian cancer 2C73 Ovarian tissue 3.58E-02 1.13E-01 4.89E-01
Pancreatic cancer 2C10 Pancreas 2.79E-03 -1.41E+00 -1.08E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.38E-01 -7.46E-03 -2.98E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.46E-03 -2.45E-01 -1.37E+00
Pituitary cancer 2D12 Pituitary tissue 2.75E-01 1.50E-01 4.65E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.75E-01 8.40E-02 4.27E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.78E-01 3.55E-03 2.44E-02
Polycythemia vera 2A20.4 Whole blood 2.38E-02 4.50E-02 2.97E-01
Pompe disease 5C51.3 Biceps muscle 8.50E-02 2.44E-01 8.52E-01
Preterm birth KA21.4Z Myometrium 3.05E-01 1.32E-01 6.38E-01
Prostate cancer 2C82 Prostate 6.48E-05 -8.87E-01 -1.63E+00
Psoriasis EA90 Skin 5.57E-15 -2.59E-01 -7.57E-01
Rectal cancer 2B92 Rectal colon tissue 6.38E-01 -5.36E-02 -3.23E-01
Renal cancer 2C90-2C91 Kidney 5.95E-04 -1.02E+00 -1.81E+00
Retinoblastoma 2D02.2 Uvea 4.97E-02 1.92E-01 1.30E+00
Rheumatoid arthritis FA20 Synovial tissue 3.74E-03 -5.93E-01 -1.76E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.21E-01 -5.16E-03 -4.21E-02
Schizophrenia 6A20 Prefrontal cortex 8.23E-01 1.74E-02 6.30E-02
Schizophrenia 6A20 Superior temporal cortex 5.51E-01 -4.68E-02 -4.09E-01
Scleroderma 4A42.Z Whole blood 9.94E-02 2.85E-02 3.26E-01
Seizure 8A60-8A6Z Whole blood 8.04E-01 -7.13E-02 -4.29E-01
Sensitive skin EK0Z Skin 7.26E-01 3.93E-02 2.24E-01
Sepsis with septic shock 1G41 Whole blood 2.84E-02 9.61E-02 3.49E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.47E-01 2.26E-01 1.01E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.26E-01 1.51E-02 5.42E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 6.52E-01 8.06E-02 5.24E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.95E-01 8.73E-05 2.45E-04
Skin cancer 2C30-2C3Z Skin 9.74E-11 -3.99E-01 -8.06E-01
Thrombocythemia 3B63 Whole blood 9.17E-01 -7.72E-03 -4.81E-02
Thrombocytopenia 3B64 Whole blood 7.61E-01 2.14E-01 1.26E+00
Thyroid cancer 2D10 Thyroid 6.04E-05 1.98E-01 4.92E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.21E-02 -2.23E-01 -1.02E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.34E-02 2.71E-01 2.00E+00
Type 2 diabetes 5A11 Liver tissue 7.01E-01 3.55E-02 2.38E-01
Ureter cancer 2C92 Urothelium 4.52E-01 -1.07E-02 -5.02E-02
Uterine cancer 2C78 Endometrium tissue 1.15E-07 -3.93E-02 -2.59E-02
Vitiligo ED63.0 Skin 3.90E-01 -4.11E-02 -2.34E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Compound heterozygous mutations in SLC30A2/ZnT2 results in low milk zinc concentrations: a novel mechanism for zinc deficiency in a breast-fed infant. PLoS One. 2013 May 31;8(5):e64045.