Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTJH79E)

DTP Name Zinc transporter ZIP9 (SLC39A9)
Gene Name SLC39A9
UniProt ID
Q9NUM3 (S39A9_HUMAN)
VARIDT ID
DTD0350
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC39A9; Solute carrier family 39 member 9; ZIP-9; ZIP9; Zinc transporter ZIP9
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Sequence
MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH
ALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFML
LVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFV
AIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEV
NATGVAMLFSAGTFLYVATVHVLPEVGGIGHSHKPDATGGRGLSRLEVAALVLGCLIPLI
LSVGHQH
Function This transporter may act as a zinc-influx transporter.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.6.1
Gene ID
55334
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.00E-03 4.46E-02 2.86E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.07E-05 2.13E-01 1.11E+00
Alopecia ED70 Skin from scalp 3.54E-02 1.11E-01 4.46E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.79E-12 -2.37E-01 -1.02E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 4.94E-01 1.75E-01 5.06E-01
Aortic stenosis BB70 Calcified aortic valve 9.98E-01 6.50E-02 7.84E-02
Apnea 7A40 Hyperplastic tonsil 4.14E-01 3.90E-02 1.21E-01
Arthropathy FA00-FA5Z Peripheral blood 9.78E-02 2.03E-01 9.19E-01
Asthma CA23 Nasal and bronchial airway 5.37E-05 -1.53E-02 -1.04E-02
Atopic dermatitis EA80 Skin 1.78E-03 6.27E-02 5.07E-01
Autism 6A02 Whole blood 2.34E-01 -1.26E-02 -8.76E-02
Autoimmune uveitis 9A96 Peripheral monocyte 4.74E-01 1.76E-01 9.35E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.39E-01 -6.50E-02 -2.76E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.82E-03 1.29E-01 4.13E-01
Batten disease 5C56.1 Whole blood 5.32E-02 6.70E-02 4.74E-01
Behcet's disease 4A62 Peripheral blood 8.12E-01 4.97E-02 2.52E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.00E-02 -5.62E-02 -4.09E-01
Bladder cancer 2C94 Bladder tissue 3.48E-04 4.27E-01 2.71E+00
Breast cancer 2C60-2C6Z Breast tissue 2.15E-12 1.03E-01 2.97E-01
Cardioembolic stroke 8B11.20 Whole blood 1.19E-03 1.80E-01 1.01E+00
Cervical cancer 2C77 Cervical tissue 1.12E-01 -8.16E-02 -3.22E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.74E-01 4.98E-02 2.35E-01
Chronic hepatitis C 1E51.1 Whole blood 7.86E-01 1.05E-02 7.02E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 9.15E-02 1.65E-01 5.46E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.66E-05 -2.72E-01 -1.01E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.54E-01 1.51E-02 9.93E-02
Colon cancer 2B90 Colon tissue 6.21E-07 -2.06E-01 -5.31E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.16E-01 -1.54E-01 -8.10E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.29E-01 -1.17E-01 -5.37E-01
Endometriosis GA10 Endometrium tissue 7.77E-01 7.00E-02 2.74E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.13E-01 -1.04E-01 -5.96E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.12E-01 1.21E-01 6.68E-01
Gastric cancer 2B72 Gastric tissue 6.92E-01 5.86E-02 1.68E-01
Glioblastopma 2A00.00 Nervous tissue 6.27E-05 -7.62E-02 -2.75E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.33E-02 3.60E-01 1.06E+00
Head and neck cancer 2D42 Head and neck tissue 6.43E-04 -1.73E-01 -5.70E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.32E-01 -1.01E-01 -4.23E-01
Huntington's disease 8A01.10 Whole blood 1.96E-01 -5.07E-02 -3.30E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.47E-01 -1.12E-01 -6.64E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.18E-02 1.10E-01 1.95E+00
Influenza 1.00E+30 Whole blood 7.35E-02 -4.14E-01 -1.70E+00
Interstitial cystitis GC00.3 Bladder tissue 8.21E-02 -1.51E-01 -1.51E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.27E-01 9.13E-02 4.43E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.48E-01 -1.39E-02 -7.11E-02
Ischemic stroke 8B11 Peripheral blood 1.66E-01 -1.42E-01 -6.59E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.61E-04 1.13E-01 3.76E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.85E-02 3.79E-01 1.51E+00
Lateral sclerosis 8B60.4 Skin 6.21E-01 2.25E-02 3.40E-01
Liver cancer 2C12.0 Liver tissue 9.88E-01 2.83E-02 7.06E-02
Liver failure DB99.7-DB99.8 Liver tissue 2.79E-01 -1.47E-01 -7.96E-01
Lung cancer 2C25 Lung tissue 1.53E-15 1.94E-01 4.98E-01
Lupus erythematosus 4A40 Whole blood 1.21E-04 9.67E-02 4.14E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.22E-01 -2.21E-02 -1.02E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.73E-01 2.75E-02 1.93E-01
Melanoma 2C30 Skin 7.00E-01 -1.12E-01 -2.61E-01
Multiple myeloma 2A83.1 Bone marrow 6.01E-03 -1.84E-01 -1.15E+00
Multiple myeloma 2A83.1 Peripheral blood 1.33E-03 2.46E-01 2.51E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.06E-01 -5.39E-02 -2.46E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.56E-01 1.74E-02 9.05E-02
Myelofibrosis 2A20.2 Whole blood 6.34E-05 1.11E-01 9.16E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.44E-01 -9.71E-02 -1.98E-01
Myopathy 8C70.6 Muscle tissue 3.77E-02 2.34E-01 1.44E+00
Neonatal sepsis KA60 Whole blood 1.88E-19 3.68E-01 1.58E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.23E-08 -5.81E-01 -4.08E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.00E-01 -6.90E-02 -3.67E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.27E-02 9.96E-02 1.26E+00
Olive pollen allergy CA08.00 Peripheral blood 5.19E-01 7.85E-02 2.90E-01
Oral cancer 2B6E Oral tissue 2.93E-01 3.07E-02 9.77E-02
Osteoarthritis FA00-FA0Z Synovial tissue 7.38E-01 1.42E-01 5.16E-01
Osteoporosis FB83.1 Bone marrow 2.64E-01 1.85E-01 7.21E-01
Ovarian cancer 2C73 Ovarian tissue 4.07E-02 2.30E-01 9.00E-01
Pancreatic cancer 2C10 Pancreas 9.23E-01 -1.46E-02 -4.52E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 1.10E-02 -1.74E-01 -1.19E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.53E-02 4.85E-02 3.83E-01
Pituitary cancer 2D12 Pituitary tissue 1.60E-01 1.02E-01 4.65E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.63E-01 2.09E-01 9.26E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.26E-01 -2.20E-02 -1.52E-01
Polycythemia vera 2A20.4 Whole blood 6.83E-05 1.10E-01 9.53E-01
Pompe disease 5C51.3 Biceps muscle 1.18E-01 -1.18E-01 -8.35E-01
Preterm birth KA21.4Z Myometrium 3.14E-02 -2.11E-01 -8.45E-01
Prostate cancer 2C82 Prostate 1.59E-07 2.21E-01 5.79E-01
Psoriasis EA90 Skin 2.99E-01 -9.83E-03 -3.44E-02
Rectal cancer 2B92 Rectal colon tissue 5.16E-01 1.36E-01 3.96E-01
Renal cancer 2C90-2C91 Kidney 8.33E-03 -2.21E-01 -8.12E-01
Retinoblastoma 2D02.2 Uvea 2.68E-03 -2.31E-01 -1.59E+00
Rheumatoid arthritis FA20 Synovial tissue 1.85E-01 -1.81E-01 -4.29E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.99E-01 2.21E-02 1.60E-01
Schizophrenia 6A20 Prefrontal cortex 1.76E-01 -3.23E-02 -1.47E-01
Schizophrenia 6A20 Superior temporal cortex 8.55E-01 -3.78E-03 -3.56E-02
Scleroderma 4A42.Z Whole blood 6.96E-04 2.92E-01 1.70E+00
Seizure 8A60-8A6Z Whole blood 6.03E-02 -1.28E-01 -9.45E-01
Sensitive skin EK0Z Skin 9.76E-01 -9.87E-02 -3.70E-01
Sepsis with septic shock 1G41 Whole blood 1.25E-24 3.03E-01 1.23E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.79E-01 -2.67E-02 -1.77E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.61E-01 -4.77E-02 -2.37E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.33E-01 7.26E-02 2.19E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.13E-01 1.57E-01 6.49E-01
Skin cancer 2C30-2C3Z Skin 2.14E-31 3.52E-01 1.08E+00
Thrombocythemia 3B63 Whole blood 3.18E-04 1.14E-01 8.79E-01
Thrombocytopenia 3B64 Whole blood 4.05E-01 -1.88E-01 -6.80E-01
Thyroid cancer 2D10 Thyroid 1.38E-08 -2.91E-01 -9.01E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.57E-01 -2.17E-02 -1.84E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.90E-01 -1.81E-01 -6.14E-01
Type 2 diabetes 5A11 Liver tissue 2.44E-01 -1.69E-01 -1.16E+00
Ureter cancer 2C92 Urothelium 4.61E-01 -2.66E-02 -9.98E-02
Uterine cancer 2C78 Endometrium tissue 2.81E-03 9.28E-02 3.07E-01
Vitiligo ED63.0 Skin 8.08E-01 -6.13E-02 -3.13E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 A ZIP6-ZIP10 heteromer controls NCAM1 phosphorylation and integration into focal adhesion complexes during epithelial-to-mesenchymal transition. Sci Rep. 2017 Jan 18;7:40313.