Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTK02RZ)

DTP Name Zinc transporter ZIP10 (SLC39A10)
Gene Name SLC39A10
UniProt ID
Q9ULF5 (S39AA_HUMAN)
VARIDT ID
DTD0338
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms KIAA1265; LZT-Hs2; SLC39A10; Solute carrier family 39 member 10; ZIP-10; ZIP10; Zinc transporter ZIP10
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Sequence
MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEK
KYYIEKLFERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEG
KHFHSHNHQHSHNHLNSENQTVTSVSTKRNHKCDPEKETVEVSVKSDDKHMHDHNHRLRH
HHRLHHHLDHNNTHHFHNDSITPSERGEPSNEPSTETNKTQEQSDVKLPKGKRKKKGRKS
NENSEVITPGFPPNHDQGEQYEHNRVHKPDRVHNPGHSHVHLPERNGHDPGRGHQDLDPD
NEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHGANSPISTDLF
TYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLL
SLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHGHS
HGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEEST
IGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIE
EEKIIDHSHSDGLHTIHEHDLHAAAHNHHGENKTVLRKHNHQWHHKHSHHSHGPCHSGSD
LKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAV
LLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDML
PEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKIVFDIQF
Function This transporter may act as a zinc-influx transporter.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.4.6
Gene ID
57181
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Reactome Pathway
Zinc influx into cells by the SLC39 gene family (R-HSA-442380 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.14E-15 7.15E-01 7.43E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.95E-03 3.45E-01 6.24E-01
Alopecia ED70 Skin from scalp 1.30E-13 -9.67E-01 -2.11E+00
Alzheimer's disease 8A20 Entorhinal cortex 2.28E-07 -6.09E-01 -8.68E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.49E-01 -2.74E-01 -8.39E-01
Aortic stenosis BB70 Calcified aortic valve 8.22E-01 6.31E-02 5.99E-02
Apnea 7A40 Hyperplastic tonsil 2.54E-01 1.83E+00 1.46E+00
Arthropathy FA00-FA5Z Peripheral blood 1.85E-01 -2.27E-01 -6.65E-01
Asthma CA23 Nasal and bronchial airway 1.13E-04 -3.42E-01 -5.75E-01
Atopic dermatitis EA80 Skin 7.09E-04 -2.08E-01 -1.34E+00
Autism 6A02 Whole blood 8.75E-01 -2.63E-02 -4.77E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.69E-03 1.39E+00 2.69E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.97E-01 8.15E-02 1.68E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.47E-01 8.30E-02 1.42E-01
Batten disease 5C56.1 Whole blood 3.35E-01 -2.08E-01 -7.41E-01
Behcet's disease 4A62 Peripheral blood 5.89E-01 2.96E-02 7.10E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.22E-01 -6.11E-01 -9.19E-01
Bladder cancer 2C94 Bladder tissue 1.95E-02 -4.02E-01 -1.88E+00
Breast cancer 2C60-2C6Z Breast tissue 3.14E-04 2.70E-01 3.64E-01
Cardioembolic stroke 8B11.20 Whole blood 2.24E-01 6.34E-02 2.26E-01
Cervical cancer 2C77 Cervical tissue 2.99E-01 1.70E-01 2.63E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.09E-01 -1.77E-01 -1.13E-01
Chronic hepatitis C 1E51.1 Whole blood 2.35E-01 -2.90E-01 -5.75E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.78E-01 3.74E-02 1.10E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.74E-05 -3.48E-01 -6.71E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.56E-01 -1.95E-01 -4.60E-01
Colon cancer 2B90 Colon tissue 4.95E-128 1.91E+00 4.04E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.26E-01 1.14E+00 1.16E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.41E-01 -1.13E-01 -2.52E-01
Endometriosis GA10 Endometrium tissue 5.48E-01 2.92E-03 6.06E-03
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.61E-01 1.97E-01 1.50E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.73E-01 -1.35E-01 -3.41E-01
Gastric cancer 2B72 Gastric tissue 2.51E-02 1.61E+00 3.35E+00
Glioblastopma 2A00.00 Nervous tissue 3.11E-19 -6.31E-01 -6.55E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.99E-01 -1.05E-01 -1.06E-01
Head and neck cancer 2D42 Head and neck tissue 2.42E-06 3.56E-01 5.20E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.26E-01 8.32E-02 6.55E-02
Huntington's disease 8A01.10 Whole blood 2.55E-01 -3.15E-01 -6.36E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.67E-02 6.04E-01 1.10E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.20E-03 -4.19E-01 -1.93E+00
Influenza 1.00E+30 Whole blood 2.20E-04 -1.28E+00 -6.78E+00
Interstitial cystitis GC00.3 Bladder tissue 8.80E-01 6.40E-02 4.09E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.10E-07 7.48E-01 1.89E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.55E-02 1.45E-01 4.82E-01
Ischemic stroke 8B11 Peripheral blood 4.55E-01 -2.49E-02 -9.46E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 9.85E-01 -2.38E-02 -6.11E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.32E-02 -1.26E+00 -1.12E+00
Lateral sclerosis 8B60.4 Skin 4.87E-02 -3.60E-01 -2.07E+00
Liver cancer 2C12.0 Liver tissue 1.05E-18 1.85E+00 2.29E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.74E-03 6.21E-01 1.07E+00
Lung cancer 2C25 Lung tissue 1.45E-28 4.96E-01 1.07E+00
Lupus erythematosus 4A40 Whole blood 1.47E-02 -1.35E-01 -1.91E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.12E-02 -9.38E-02 -1.70E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.79E-01 -6.19E-02 -9.78E-02
Melanoma 2C30 Skin 2.24E-01 -1.82E-01 -2.53E-01
Multiple myeloma 2A83.1 Bone marrow 2.64E-06 9.59E-01 3.65E+00
Multiple myeloma 2A83.1 Peripheral blood 3.58E-01 -2.95E-02 -7.99E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.52E-01 -4.27E-03 -3.15E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.17E-01 -6.19E-02 -1.18E-01
Myelofibrosis 2A20.2 Whole blood 7.74E-01 8.47E-02 2.18E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.19E-03 -4.64E-01 -6.45E-01
Myopathy 8C70.6 Muscle tissue 4.81E-02 8.30E-01 1.15E+00
Neonatal sepsis KA60 Whole blood 7.71E-18 -1.02E+00 -1.42E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.52E-07 1.90E+00 3.70E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.05E-01 1.02E-01 1.27E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.14E-02 -5.05E-01 -1.28E+00
Olive pollen allergy CA08.00 Peripheral blood 5.99E-02 -3.80E-01 -9.45E-01
Oral cancer 2B6E Oral tissue 1.93E-07 1.76E+00 1.43E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.98E-01 2.54E-01 3.23E-01
Osteoporosis FB83.1 Bone marrow 8.82E-01 -3.97E-02 -9.42E-02
Ovarian cancer 2C73 Ovarian tissue 1.03E-03 1.21E+00 1.76E+00
Pancreatic cancer 2C10 Pancreas 4.37E-03 7.49E-01 7.41E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.70E-01 -8.48E-02 -1.12E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.71E-02 -1.89E-01 -8.85E-01
Pituitary cancer 2D12 Pituitary tissue 4.24E-04 8.49E-01 1.60E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.55E-04 8.53E-01 1.95E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.30E-01 -8.27E-03 -2.92E-02
Polycythemia vera 2A20.4 Whole blood 9.06E-04 -4.02E-01 -1.03E+00
Pompe disease 5C51.3 Biceps muscle 1.50E-01 2.34E-01 7.65E-01
Preterm birth KA21.4Z Myometrium 7.43E-01 -1.68E-01 -2.42E-01
Prostate cancer 2C82 Prostate 3.34E-01 4.93E-01 6.21E-01
Psoriasis EA90 Skin 6.86E-06 -2.45E-01 -4.83E-01
Rectal cancer 2B92 Rectal colon tissue 1.12E-07 1.51E+00 6.15E+00
Renal cancer 2C90-2C91 Kidney 7.51E-02 7.37E-01 6.36E-01
Retinoblastoma 2D02.2 Uvea 2.65E-01 1.01E-01 2.67E-01
Rheumatoid arthritis FA20 Synovial tissue 5.62E-01 -4.84E-01 -8.09E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.54E-01 -2.35E-02 -7.59E-02
Schizophrenia 6A20 Prefrontal cortex 5.91E-03 -6.52E-01 -5.35E-01
Schizophrenia 6A20 Superior temporal cortex 8.40E-01 -7.27E-03 -1.06E-02
Scleroderma 4A42.Z Whole blood 5.55E-01 -2.13E-02 -4.94E-02
Seizure 8A60-8A6Z Whole blood 6.38E-01 4.27E-01 6.67E-01
Sensitive skin EK0Z Skin 5.74E-01 -1.84E-02 -1.08E-01
Sepsis with septic shock 1G41 Whole blood 3.81E-51 -1.05E+00 -1.71E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.55E-01 -6.98E-01 -7.55E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.99E-01 3.12E-01 3.54E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.87E-01 -1.60E-01 -2.40E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.24E-03 9.92E-01 3.38E+00
Skin cancer 2C30-2C3Z Skin 1.22E-09 4.22E-01 7.63E-01
Thrombocythemia 3B63 Whole blood 6.39E-02 -2.42E-01 -6.36E-01
Thrombocytopenia 3B64 Whole blood 3.69E-01 -2.79E-01 -2.18E-01
Thyroid cancer 2D10 Thyroid 1.24E-14 7.47E-01 1.56E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.45E-07 1.34E+00 2.62E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.97E-02 -7.74E-01 -3.10E+00
Type 2 diabetes 5A11 Liver tissue 7.30E-01 3.60E-01 5.24E-01
Ureter cancer 2C92 Urothelium 1.52E-01 1.87E-01 5.35E-01
Uterine cancer 2C78 Endometrium tissue 1.12E-09 6.65E-01 9.76E-01
Vitiligo ED63.0 Skin 7.58E-03 2.45E-01 1.27E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Zinc transporter SLC39A10/ZIP10 facilitates antiapoptotic signaling during early B-cell development. Proc Natl Acad Sci U S A. 2014 Aug 12;111(32):11780-5.