Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKMECW)

DTP Name Zinc transporter 3 (SLC30A3)
Gene Name SLC30A3
UniProt ID
Q99726 (ZNT3_HUMAN)
VARIDT ID
DTD0272
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC30A3; Solute carrier family 30 member 3; ZNT3; ZnT-3
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Sequence
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL
PPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSL
FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAM
LLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVL
GDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNV
GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF
GFSSCTLQVEQYQPEMAQCLRCQEPPQA
Function This transporter involved in accumulation of zinc in synaptic vesicles.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.3.2
Gene ID
7781
Reactome Pathway
Zinc efflux and compartmentalization by the SLC30 family (R-HSA-435368 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.50E-01 3.24E-02 1.14E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.72E-01 -6.12E-02 -1.48E-01
Alopecia ED70 Skin from scalp 5.61E-05 -2.37E-01 -7.55E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.68E-13 -7.22E-01 -9.86E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.48E-01 -1.22E-01 -3.24E-01
Aortic stenosis BB70 Calcified aortic valve 7.32E-01 -1.83E-01 -2.42E-01
Apnea 7A40 Hyperplastic tonsil 6.16E-02 1.82E-01 4.67E-01
Arthropathy FA00-FA5Z Peripheral blood 1.48E-01 9.09E-02 6.28E-01
Asthma CA23 Nasal and bronchial airway 4.09E-03 -1.91E-01 -2.94E-01
Atopic dermatitis EA80 Skin 6.24E-13 1.92E-01 1.75E+00
Autism 6A02 Whole blood 2.36E-02 -4.78E-02 -2.44E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.09E-01 -1.13E-01 -5.51E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.46E-01 1.20E-01 7.04E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.67E-02 -1.02E-01 -2.55E-01
Batten disease 5C56.1 Whole blood 7.67E-01 5.12E-02 5.92E-01
Behcet's disease 4A62 Peripheral blood 4.31E-02 5.24E-02 2.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.14E-02 -1.11E-01 -5.66E-01
Bladder cancer 2C94 Bladder tissue 5.40E-05 8.35E-01 3.72E+00
Breast cancer 2C60-2C6Z Breast tissue 7.40E-05 -9.69E-02 -2.30E-01
Cardioembolic stroke 8B11.20 Whole blood 2.42E-04 1.08E-01 5.55E-01
Cervical cancer 2C77 Cervical tissue 7.69E-03 -8.34E-02 -4.88E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.32E-01 -1.06E-02 -3.20E-02
Chronic hepatitis C 1E51.1 Whole blood 4.14E-01 1.69E-01 6.53E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.60E-02 1.29E-01 3.82E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.57E-02 1.13E-01 3.82E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.05E-01 -2.36E-01 -1.27E+00
Colon cancer 2B90 Colon tissue 1.78E-05 8.82E-02 3.01E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.15E-01 -1.27E-01 -2.98E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.38E-01 -2.25E-01 -8.78E-01
Endometriosis GA10 Endometrium tissue 9.85E-01 1.58E-03 6.19E-03
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.79E-01 -3.07E-02 -1.90E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.73E-05 -6.51E-01 -2.33E+00
Gastric cancer 2B72 Gastric tissue 4.85E-01 -1.13E-01 -2.01E-01
Glioblastopma 2A00.00 Nervous tissue 1.36E-99 -1.43E+00 -1.68E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.12E-06 -8.88E-01 -3.16E+00
Head and neck cancer 2D42 Head and neck tissue 3.25E-03 1.20E-01 3.04E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.49E-01 1.44E-02 1.74E-02
Huntington's disease 8A01.10 Whole blood 1.48E-01 1.11E-01 4.80E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.61E-01 -1.52E-01 -5.71E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.67E-01 5.17E-02 4.11E-01
Influenza 1.00E+30 Whole blood 9.70E-01 -9.42E-02 -5.21E-01
Interstitial cystitis GC00.3 Bladder tissue 5.12E-02 1.60E-01 1.18E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.25E-01 -1.60E-03 -4.05E-03
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.38E-01 3.53E-01 6.24E-01
Ischemic stroke 8B11 Peripheral blood 1.48E-01 4.70E-02 2.49E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.47E-02 8.68E-02 3.72E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.48E-02 1.31E-01 5.06E-01
Lateral sclerosis 8B60.4 Skin 1.48E-01 7.72E-02 8.90E-01
Liver cancer 2C12.0 Liver tissue 2.21E-11 -3.58E-01 -1.55E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.01E-04 -3.24E-01 -2.15E+00
Lung cancer 2C25 Lung tissue 4.14E-06 1.15E-01 3.67E-01
Lupus erythematosus 4A40 Whole blood 3.44E-02 -1.04E-01 -1.47E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.19E-01 -6.11E-03 -2.52E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.51E-01 7.99E-02 4.34E-01
Melanoma 2C30 Skin 2.02E-01 4.17E-01 3.40E-01
Multiple myeloma 2A83.1 Bone marrow 5.66E-05 -7.59E-01 -3.15E+00
Multiple myeloma 2A83.1 Peripheral blood 9.76E-02 1.90E-01 1.25E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.51E-01 9.22E-03 3.84E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.46E-02 4.33E-02 1.67E-01
Myelofibrosis 2A20.2 Whole blood 8.12E-02 6.69E-02 5.61E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.39E-01 4.75E-01 6.10E-01
Myopathy 8C70.6 Muscle tissue 5.36E-01 1.07E-02 1.18E-01
Neonatal sepsis KA60 Whole blood 7.98E-02 -5.79E-02 -2.18E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.04E-03 -8.61E-01 -1.64E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.94E-01 1.77E-04 1.54E-03
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.23E-02 1.05E-01 2.16E+00
Olive pollen allergy CA08.00 Peripheral blood 3.24E-02 2.08E-01 2.12E+00
Oral cancer 2B6E Oral tissue 1.99E-02 -5.84E-01 -1.04E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.58E-01 -6.01E-02 -2.68E-01
Osteoporosis FB83.1 Bone marrow 4.76E-01 2.09E-02 1.83E-01
Ovarian cancer 2C73 Ovarian tissue 5.03E-02 -4.23E-01 -9.73E-01
Pancreatic cancer 2C10 Pancreas 1.71E-01 -2.75E-01 -6.30E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.55E-02 1.05E-01 5.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.62E-01 -6.97E-02 -4.53E-01
Pituitary cancer 2D12 Pituitary tissue 5.96E-01 -5.10E-02 -8.99E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.67E-01 1.05E-01 2.98E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.45E-01 1.06E-01 8.09E-01
Polycythemia vera 2A20.4 Whole blood 7.84E-05 1.18E-01 9.01E-01
Pompe disease 5C51.3 Biceps muscle 1.23E-01 -1.26E-01 -7.42E-01
Preterm birth KA21.4Z Myometrium 9.53E-01 1.13E-02 6.66E-02
Prostate cancer 2C82 Prostate 1.25E-03 -1.01E+00 -9.52E-01
Psoriasis EA90 Skin 8.42E-08 -1.93E-01 -3.71E-01
Rectal cancer 2B92 Rectal colon tissue 2.41E-02 1.44E-01 8.55E-01
Renal cancer 2C90-2C91 Kidney 9.05E-01 -2.93E-01 -5.97E-01
Retinoblastoma 2D02.2 Uvea 9.11E-02 -1.14E-01 -5.62E-01
Rheumatoid arthritis FA20 Synovial tissue 7.66E-02 -1.66E-01 -5.07E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.54E-01 -3.16E-02 -2.46E-01
Schizophrenia 6A20 Prefrontal cortex 3.90E-02 -2.20E-01 -2.53E-01
Schizophrenia 6A20 Superior temporal cortex 9.82E-01 -3.37E-02 -1.00E-01
Scleroderma 4A42.Z Whole blood 3.18E-02 9.99E-02 8.17E-01
Seizure 8A60-8A6Z Whole blood 8.81E-01 1.14E-01 5.17E-01
Sensitive skin EK0Z Skin 5.59E-01 -4.33E-02 -2.47E-01
Sepsis with septic shock 1G41 Whole blood 1.83E-03 1.22E-01 4.42E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.30E-01 7.63E-01 1.45E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.48E-01 1.19E-02 4.28E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 2.29E-01 1.62E-01 1.13E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.42E-01 -6.12E-01 -1.71E+00
Skin cancer 2C30-2C3Z Skin 8.45E-02 -1.65E-01 -2.34E-01
Thrombocythemia 3B63 Whole blood 1.88E-01 1.37E-01 1.13E+00
Thrombocytopenia 3B64 Whole blood 8.18E-01 6.07E-02 3.39E-01
Thyroid cancer 2D10 Thyroid 1.18E-13 2.64E-01 9.20E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.04E-01 -1.53E-02 -4.42E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.57E-01 -4.28E-01 -1.99E+00
Type 2 diabetes 5A11 Liver tissue 4.41E-01 -1.45E-01 -4.05E-01
Ureter cancer 2C92 Urothelium 6.42E-01 -2.68E-02 -5.87E-02
Uterine cancer 2C78 Endometrium tissue 7.16E-22 -4.33E-01 -1.68E+00
Vitiligo ED63.0 Skin 5.41E-01 -3.10E-02 -1.85E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Loss of synaptic Zn2+ transporter function increases risk of febrile seizures. Sci Rep. 2015 Dec 9;5:17816.