Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKPRIL)

DTP Name Zinc transporter 6 (SLC30A6)
Gene Name SLC30A6
UniProt ID
Q6NXT4 (ZNT6_HUMAN)
VARIDT ID
DTD0275
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms MST103; MSTP103; SLC30A6; Solute carrier family 30 member 6; ZNT6; ZnT-6
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Tissue Specificity Expressed in brain; especially in cerebellum,hippocampus, parahippocampal gyrus, superior and middle temporalgyrus. Also expressed in B-cells, colon, eye, and lung. Lowerexpression was present in bone, brain, cervix, ear, heart, kidney,muscle, nerve, pancreas, prostate, skin, stomach, and testis.
Sequence
MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIAL
TAYTYLTIFDLFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILK
ESAERFLEQPEIHTGRLLVGTFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLS
RSLCGIIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTF
GTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVH
VRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIP
MPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPY
SSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP
Function This transporter is zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.4.4
Gene ID
55676
Reactome Pathway
Zinc efflux and compartmentalization by the SLC30 family (R-HSA-435368 )
Insulin processing (R-HSA-264876 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.19E-13 -2.22E-01 -7.32E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.95E-02 1.07E-01 3.46E-01
Alopecia ED70 Skin from scalp 1.93E-01 -1.49E-01 -3.47E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.08E-01 -6.98E-03 -3.60E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.83E-01 2.84E-02 1.14E-01
Aortic stenosis BB70 Calcified aortic valve 5.18E-01 -5.50E-01 -8.84E-01
Apnea 7A40 Hyperplastic tonsil 2.77E-01 -2.20E-01 -1.38E+00
Arthropathy FA00-FA5Z Peripheral blood 2.17E-01 -6.21E-02 -4.93E-01
Asthma CA23 Nasal and bronchial airway 6.69E-01 -1.79E-02 -5.53E-02
Atopic dermatitis EA80 Skin 3.99E-07 3.24E-01 2.18E+00
Autism 6A02 Whole blood 8.76E-01 -5.44E-02 -2.33E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.78E-01 4.41E-01 1.27E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.83E-02 -5.30E-01 -1.53E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.03E-02 -7.04E-02 -3.15E-01
Batten disease 5C56.1 Whole blood 1.28E-01 -7.20E-02 -1.08E+00
Behcet's disease 4A62 Peripheral blood 6.78E-01 -5.70E-03 -2.81E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.45E-01 -2.39E-02 -1.28E-01
Bladder cancer 2C94 Bladder tissue 5.27E-01 1.79E-02 1.14E-01
Breast cancer 2C60-2C6Z Breast tissue 4.49E-57 3.43E-01 1.26E+00
Cardioembolic stroke 8B11.20 Whole blood 9.45E-02 1.28E-01 4.42E-01
Cervical cancer 2C77 Cervical tissue 4.80E-04 2.02E-01 8.86E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.74E-01 -3.04E-02 -1.01E-01
Chronic hepatitis C 1E51.1 Whole blood 3.95E-01 4.23E-02 1.57E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.28E-01 -3.48E-03 -1.15E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.10E-01 -7.61E-02 -3.27E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.86E-02 3.43E-01 1.87E+00
Colon cancer 2B90 Colon tissue 2.38E-11 1.74E-01 6.45E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.57E-01 -2.28E-01 -1.01E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.48E-01 6.10E-02 5.54E-01
Endometriosis GA10 Endometrium tissue 1.27E-01 -2.57E-01 -1.24E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.97E-01 -8.80E-02 -4.06E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.74E-01 3.73E-02 1.59E-01
Gastric cancer 2B72 Gastric tissue 2.12E-01 2.24E-01 4.54E-01
Glioblastopma 2A00.00 Nervous tissue 5.99E-159 5.66E-01 2.03E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.60E-01 -4.16E-03 -3.79E-03
Head and neck cancer 2D42 Head and neck tissue 3.63E-18 2.57E-01 1.18E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.12E-01 -1.50E-01 -5.83E-01
Huntington's disease 8A01.10 Whole blood 8.18E-03 -1.95E-01 -1.19E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.67E-02 -3.30E-01 -1.35E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.29E-02 1.08E-01 1.24E+00
Influenza 1.00E+30 Whole blood 3.92E-03 -4.75E-01 -2.36E+00
Interstitial cystitis GC00.3 Bladder tissue 6.62E-01 -2.99E-03 -1.72E-02
Intracranial aneurysm 8B01.0 Intracranial artery 2.01E-02 4.64E-01 1.46E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.41E-01 7.62E-02 1.78E-01
Ischemic stroke 8B11 Peripheral blood 1.04E-02 -1.65E-01 -5.29E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.78E-06 -1.78E-01 -7.21E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.90E-01 1.33E-01 7.12E-01
Lateral sclerosis 8B60.4 Skin 3.33E-01 1.34E-01 8.67E-01
Liver cancer 2C12.0 Liver tissue 1.29E-06 2.59E-01 8.18E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.71E-03 -2.84E-01 -1.43E+00
Lung cancer 2C25 Lung tissue 2.59E-59 5.03E-01 1.66E+00
Lupus erythematosus 4A40 Whole blood 5.38E-03 7.95E-02 1.77E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.99E-01 7.26E-02 1.34E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.60E-01 8.79E-04 4.86E-03
Melanoma 2C30 Skin 4.71E-02 1.27E-01 4.52E-01
Multiple myeloma 2A83.1 Bone marrow 1.74E-03 5.36E-01 1.67E+00
Multiple myeloma 2A83.1 Peripheral blood 2.97E-01 -4.53E-01 -7.66E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.24E-01 -4.87E-02 -4.37E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.58E-01 -1.25E-02 -5.56E-02
Myelofibrosis 2A20.2 Whole blood 3.73E-02 1.40E-01 7.05E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.54E-03 -4.00E-01 -4.89E-01
Myopathy 8C70.6 Muscle tissue 2.40E-01 -4.96E-03 -4.08E-02
Neonatal sepsis KA60 Whole blood 4.74E-02 -1.25E-01 -4.45E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.21E-06 1.03E+00 2.55E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.08E-01 1.34E-01 4.67E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.68E-01 -1.43E-01 -8.55E-01
Olive pollen allergy CA08.00 Peripheral blood 8.91E-02 -1.78E-01 -7.57E-01
Oral cancer 2B6E Oral tissue 1.52E-10 8.00E-01 2.02E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.07E-01 4.62E-01 8.49E-01
Osteoporosis FB83.1 Bone marrow 3.38E-02 -3.17E-01 -2.25E+00
Ovarian cancer 2C73 Ovarian tissue 7.57E-06 6.25E-01 3.05E+00
Pancreatic cancer 2C10 Pancreas 1.78E-03 1.89E-01 6.76E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.62E-01 -5.69E-03 -2.93E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.53E-01 -4.98E-02 -2.33E-01
Pituitary cancer 2D12 Pituitary tissue 2.30E-03 4.16E-01 1.25E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.11E-02 3.15E-01 7.72E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.93E-01 2.04E-02 7.62E-02
Polycythemia vera 2A20.4 Whole blood 2.34E-05 1.92E-01 9.99E-01
Pompe disease 5C51.3 Biceps muscle 1.93E-01 -1.34E-01 -6.36E-01
Preterm birth KA21.4Z Myometrium 1.47E-01 -4.39E-02 -1.86E-01
Prostate cancer 2C82 Prostate 1.39E-04 5.27E-01 9.66E-01
Psoriasis EA90 Skin 7.72E-03 2.03E-01 6.09E-01
Rectal cancer 2B92 Rectal colon tissue 6.93E-02 3.48E-01 1.09E+00
Renal cancer 2C90-2C91 Kidney 1.26E-03 5.45E-01 1.37E+00
Retinoblastoma 2D02.2 Uvea 8.72E-09 6.32E-01 3.77E+00
Rheumatoid arthritis FA20 Synovial tissue 4.94E-02 4.10E-01 1.29E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.55E-02 1.33E-01 6.83E-01
Schizophrenia 6A20 Prefrontal cortex 6.68E-01 -5.85E-03 -1.67E-02
Schizophrenia 6A20 Superior temporal cortex 1.50E-01 -3.25E-02 -3.72E-01
Scleroderma 4A42.Z Whole blood 1.94E-01 -1.39E-01 -6.74E-01
Seizure 8A60-8A6Z Whole blood 1.72E-02 1.44E-01 8.78E-01
Sensitive skin EK0Z Skin 9.22E-01 5.31E-02 3.29E-01
Sepsis with septic shock 1G41 Whole blood 2.72E-03 5.14E-02 1.92E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.81E-02 3.55E-01 7.72E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.36E-01 1.14E-02 6.52E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 6.96E-03 -3.53E-01 -4.21E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.52E-01 2.34E-01 1.31E+00
Skin cancer 2C30-2C3Z Skin 3.94E-32 4.59E-01 1.18E+00
Thrombocythemia 3B63 Whole blood 1.04E-03 1.48E-01 7.40E-01
Thrombocytopenia 3B64 Whole blood 6.94E-02 -6.31E-01 -1.06E+00
Thyroid cancer 2D10 Thyroid 1.22E-02 3.87E-02 1.87E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.54E-02 6.13E-02 2.75E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.59E-01 6.20E-02 3.07E-01
Type 2 diabetes 5A11 Liver tissue 9.61E-01 4.34E-02 1.84E-01
Ureter cancer 2C92 Urothelium 1.50E-01 5.19E-02 4.65E-01
Uterine cancer 2C78 Endometrium tissue 2.96E-14 2.76E-01 9.37E-01
Vitiligo ED63.0 Skin 1.28E-02 -1.72E-01 -1.13E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Altered expression of two zinc transporters, SLC30A5 and SLC30A6, underlies a mammary gland disorder of reduced zinc secretion into milk. Genes Nutr. 2015 Sep;10(5):487.