Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKVEXO)

DTP Name ATP-binding cassette sub-family B member 5 (ABCB5)
Gene Name ABCB5
UniProt ID
Q2M3G0 (ABCB5_HUMAN)
VARIDT ID
DTD0051
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABCB5; ABCB5 P-gp; ABCB5alpha; ABCB5beta; EST422562; P-glycoprotein ABCB5
DTP Family ATP-Binding Cassette (ABC) Superfamily
Multidrug Resistance Exporter (MDR) Family (ABCB)
Tissue Specificity Expressed by CD133-expressing progenitor cellsamong epidermal melanocytes (at protein level). Widely expressedwith specific expression in pigment cells. Highly expressed inseveral malignant tissues: highly expressed in clinical melanomas,with low expression in normal skin. In melanoma, marks malignantmelanoma-initiating cells (MMIC), in which clinical virulenceresides as a consequence of unlimited self-renewal capacity,resulting in inexorable tumor progression and metastasis. Alsohighly expressed in a number of leukemia cells. Expressed in basallimbal epithelium.
Sequence
MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGA
CLPLMPLVLGEMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIF
GYIQISLWIITAARQTKRIRKQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGD
KIALLFQNMSTFSIGLAVGLVKGWKLTLVTLSTSPLIMASAAACSRMVISLTSKELSAYS
KAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFGIKRTIASKVSLGAVYFFMNG
TYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFAIARGAAFHIF
QVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISN
NIKYGRDDVTDEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALV
RNPKILILDEATSALDSESKSAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGML
AEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFID
KAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASVLNGTVHPVFSIIFAKIITMF
GNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRHLAFKAMLYQD
IAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMY
EEMLQTQHRNTSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTA
IAYGAMAIGETLVLAPEYSKAKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREV
SFFYPCRPDVFILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVD
AKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANAANIHSFIEG
LPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDSEKVVQHALDK
ARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ
Function
This drug efflux transporter present in a number of stem cells that acts as a regulator of cellular differentiation. Able to mediate efflux from cells of the rhodamine dye and of the therapeutic drug doxorubicin.
TCDB ID
3.A.1.201.13
Gene ID
340273
KEGG Pathway
( )
Reactome Pathway
ABC-family proteins mediated transport (R-HSA-382556 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
3 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Brigatinib DM7W94S Anaplastic large cell lymphoma 2A90.A Approved [1]
Doxorubicin DMVP5YE Solid tumour/cancer 2A00-2F9Z Approved [2]
Fostamatinib DM6AUHV Immune thrombocytopenic purpura 3B64.13 Approved [3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.23E-01 -1.79E-02 -1.15E-01
Adrenocortical carcinoma 2D11.Z Kidney 4.06E-03 -3.26E-02 -2.10E-01
Alopecia ED70 Skin from scalp 3.18E-03 -1.34E-01 -5.17E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.18E-02 -2.26E-02 -1.97E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.04E-01 -1.87E-02 -2.70E-01
Aortic stenosis BB70 Calcified aortic valve 9.66E-01 -9.81E-02 -2.28E-01
Apnea 7A40 Hyperplastic tonsil 7.65E-01 2.32E-02 1.75E-01
Arthropathy FA00-FA5Z Peripheral blood 5.61E-01 3.39E-02 4.55E-01
Asthma CA23 Nasal and bronchial airway 3.35E-01 -2.42E-02 -1.22E-01
Atopic dermatitis EA80 Skin 2.79E-05 -1.50E-01 -5.60E-01
Autism 6A02 Whole blood 8.59E-01 -6.32E-03 -4.29E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.60E-01 -3.21E-02 -1.63E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.49E-01 -2.07E-02 -2.93E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.94E-01 -4.03E-02 -2.80E-01
Batten disease 5C56.1 Whole blood 2.35E-02 1.23E-01 2.23E+00
Behcet's disease 4A62 Peripheral blood 6.96E-01 -5.18E-02 -5.35E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.90E-02 -4.20E-02 -4.44E-01
Bladder cancer 2C94 Bladder tissue 2.07E-03 3.72E-01 2.12E+00
Breast cancer 2C60-2C6Z Breast tissue 9.17E-65 -9.31E-01 -1.46E+00
Cardioembolic stroke 8B11.20 Whole blood 2.04E-01 -3.48E-03 -2.94E-02
Cervical cancer 2C77 Cervical tissue 4.19E-02 -8.22E-02 -3.25E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.51E-01 3.09E-02 2.96E-01
Chronic hepatitis C 1E51.1 Whole blood 3.14E-01 1.10E-01 8.58E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.81E-02 9.05E-02 7.83E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.91E-01 3.14E-03 2.71E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.50E-01 -1.62E-02 -1.98E-01
Colon cancer 2B90 Colon tissue 1.65E-02 4.86E-02 2.73E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.61E-01 -3.78E-03 -1.97E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.82E-01 -1.07E-01 -8.77E-01
Endometriosis GA10 Endometrium tissue 9.75E-01 -3.17E-02 -2.28E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.02E-01 -9.04E-02 -7.43E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.53E-04 -1.28E-01 -7.81E-01
Gastric cancer 2B72 Gastric tissue 9.75E-01 -5.81E-02 -1.00E+00
Glioblastopma 2A00.00 Nervous tissue 3.28E-01 -1.38E-02 -6.59E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.23E-04 -5.07E-01 -2.18E+00
Head and neck cancer 2D42 Head and neck tissue 4.39E-01 6.00E-03 4.62E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.16E-02 -3.89E-02 -1.76E-01
Huntington's disease 8A01.10 Whole blood 2.38E-01 -4.41E-02 -2.58E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.91E-01 6.39E-02 4.51E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.37E-01 -4.15E-03 -4.85E-02
Influenza 1.00E+30 Whole blood 4.51E-01 -1.02E-01 -5.97E-01
Interstitial cystitis GC00.3 Bladder tissue 8.98E-01 -1.67E-02 -1.92E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.69E-02 1.73E-01 1.61E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.47E-01 4.65E-02 2.30E-01
Ischemic stroke 8B11 Peripheral blood 2.96E-02 1.26E-01 7.76E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.23E-02 2.22E-02 1.38E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.53E-01 1.95E-01 1.07E+00
Lateral sclerosis 8B60.4 Skin 9.02E-02 6.61E-02 1.92E+00
Liver cancer 2C12.0 Liver tissue 4.68E-02 -3.20E-02 -1.58E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.92E-01 7.24E-03 4.48E-02
Lung cancer 2C25 Lung tissue 5.60E-01 -1.37E-02 -1.15E-01
Lupus erythematosus 4A40 Whole blood 5.39E-01 -8.38E-02 -2.15E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.71E-01 -7.59E-02 -3.46E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.55E-01 1.12E-03 1.17E-02
Melanoma 2C30 Skin 1.55E-04 7.48E-01 5.41E-01
Multiple myeloma 2A83.1 Bone marrow 1.97E-02 -1.98E-01 -1.28E+00
Multiple myeloma 2A83.1 Peripheral blood 2.15E-01 4.55E-02 4.41E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.37E-01 -4.46E-02 -3.39E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.70E-01 5.67E-03 3.35E-02
Myelofibrosis 2A20.2 Whole blood 2.74E-01 4.63E-02 3.68E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.82E-02 2.83E-01 5.36E-01
Myopathy 8C70.6 Muscle tissue 4.78E-01 3.65E-02 4.09E-01
Neonatal sepsis KA60 Whole blood 2.99E-02 3.74E-02 2.47E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.18E-04 -4.95E-01 -1.40E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.84E-01 3.12E-02 4.29E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.95E-01 8.28E-02 2.45E-01
Olive pollen allergy CA08.00 Peripheral blood 3.88E-02 8.52E-02 9.88E-01
Oral cancer 2B6E Oral tissue 2.68E-03 -2.21E-01 -1.43E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.65E-02 9.68E-02 6.60E-01
Osteoporosis FB83.1 Bone marrow 2.63E-01 1.49E-01 2.69E+00
Ovarian cancer 2C73 Ovarian tissue 9.66E-02 -1.03E-01 -4.35E-01
Pancreatic cancer 2C10 Pancreas 5.86E-01 -1.32E-01 -5.70E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.65E-01 1.41E-02 1.55E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.37E-01 1.96E-02 2.45E-01
Pituitary cancer 2D12 Pituitary tissue 3.87E-01 1.53E-01 6.22E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.88E-03 1.89E-01 1.75E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.78E-03 7.39E-02 1.09E+00
Polycythemia vera 2A20.4 Whole blood 5.50E-01 1.01E-02 6.99E-02
Pompe disease 5C51.3 Biceps muscle 6.55E-01 -2.39E-02 -2.26E-01
Preterm birth KA21.4Z Myometrium 2.82E-01 -8.68E-02 -6.57E-01
Prostate cancer 2C82 Prostate 2.06E-05 -3.59E-01 -1.60E+00
Psoriasis EA90 Skin 4.95E-10 -3.05E-01 -6.52E-01
Rectal cancer 2B92 Rectal colon tissue 2.86E-01 6.19E-02 5.25E-01
Renal cancer 2C90-2C91 Kidney 5.72E-01 -9.34E-02 -5.53E-01
Retinoblastoma 2D02.2 Uvea 2.26E-10 5.20E+00 3.99E+01
Rheumatoid arthritis FA20 Synovial tissue 2.17E-10 2.10E-01 8.66E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.09E-01 -8.12E-03 -9.13E-02
Schizophrenia 6A20 Prefrontal cortex 7.29E-02 3.19E-02 2.13E-01
Schizophrenia 6A20 Superior temporal cortex 5.28E-01 -9.91E-03 -1.94E-01
Scleroderma 4A42.Z Whole blood 9.81E-02 3.56E-02 2.90E-01
Seizure 8A60-8A6Z Whole blood 8.81E-01 3.53E-03 3.59E-02
Sensitive skin EK0Z Skin 4.99E-01 -1.24E-01 -9.61E-01
Sepsis with septic shock 1G41 Whole blood 1.46E-02 2.48E-04 1.50E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.52E-02 5.51E-01 1.86E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.54E-02 1.03E-01 1.22E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.05E-01 3.68E-02 6.24E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.10E-01 -9.69E-02 -1.16E+00
Skin cancer 2C30-2C3Z Skin 2.21E-30 4.76E-01 9.83E-01
Thrombocythemia 3B63 Whole blood 4.62E-01 -1.59E-02 -1.15E-01
Thrombocytopenia 3B64 Whole blood 2.54E-01 1.24E-02 1.13E-01
Thyroid cancer 2D10 Thyroid 2.12E-03 5.77E-02 3.56E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.11E-01 -1.29E-01 -1.23E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.75E-02 4.36E-01 6.14E+00
Type 2 diabetes 5A11 Liver tissue 6.04E-01 -5.31E-02 -4.50E-01
Ureter cancer 2C92 Urothelium 5.34E-01 -3.04E-02 -2.84E-01
Uterine cancer 2C78 Endometrium tissue 9.53E-05 -1.02E-01 -4.44E-01
Vitiligo ED63.0 Skin 4.38E-01 -9.66E-02 -1.16E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 NDA/BLA Multidisciplinary Review and Evaluation of ALUNBRIG (brigatinib) From FDA.
2 ABCB5-mediated doxorubicin transport and chemoresistance in human malignant melanoma. Cancer Res. 2005 May 15;65(10):4320-33.
3 DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB12010)