Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTLPQGT)

DTP Name Zinc transporter ZIP8 (SLC39A8)
Gene Name SLC39A8
UniProt ID
Q9C0K1 (S39A8_HUMAN)
VARIDT ID
DTD0349
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
BCG-induced integral membrane protein in monocyte clone 103 protein; BIGM103; CDG2N; LIV-1 subfamily of ZIP zinc transporter 6; LZT-Hs6; PP3105; SLC39A8; Solute carrier family 39 member 8; ZIP-8; ZIP8; Zinc transporter ZIP8
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Tissue Specificity Expressed in thymus, placenta, lung, liver,pancreas and, to a lower extent, in spleen, testis, ovary, smallintestine, colon, leukocyte, heart. Highest expression is observedin pancreas.
Sequence
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASR
VGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHK
TRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQ
LIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQE
KTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI
GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGM
STRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLR
EKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE
Function This transporter mediates the influx of manganese and zinc. Plays a role in manganese reabsorption in the proximal tubule of the kidney and in manganese uptake into the brain.
Endogenous Substrate(s) Cd2+; Mn2+; Zn2+
TCDB ID
2.A.5.4.15
Gene ID
64116
KEGG Pathway
Ferroptosis (hsa04216 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Reactome Pathway
Zinc influx into cells by the SLC39 gene family (R-HSA-442380 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.54E-13 1.95E-01 8.21E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.64E-04 2.07E-01 8.87E-01
Alopecia ED70 Skin from scalp 1.09E-03 -3.67E-01 -7.19E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.17E-02 7.13E-02 3.22E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.50E-01 2.16E-02 1.26E-01
Aortic stenosis BB70 Calcified aortic valve 3.31E-01 1.67E-01 4.04E-01
Apnea 7A40 Hyperplastic tonsil 1.44E-01 -1.72E-01 -1.50E+00
Arthropathy FA00-FA5Z Peripheral blood 4.79E-01 6.99E-02 4.69E-01
Asthma CA23 Nasal and bronchial airway 2.10E-03 3.85E-01 4.91E-01
Atopic dermatitis EA80 Skin 6.31E-01 -8.83E-02 -6.09E-01
Autism 6A02 Whole blood 4.44E-01 -2.40E-02 -1.24E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.94E-02 -3.09E-01 -2.55E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.28E-01 2.50E-01 9.58E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.30E-06 1.25E-01 6.16E-01
Batten disease 5C56.1 Whole blood 4.88E-01 -4.77E-02 -2.72E-01
Behcet's disease 4A62 Peripheral blood 5.36E-01 -1.65E-01 -5.16E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.25E-01 -5.02E-02 -3.07E-01
Bladder cancer 2C94 Bladder tissue 9.24E-01 8.34E-02 3.11E-01
Breast cancer 2C60-2C6Z Breast tissue 1.10E-03 -8.97E-02 -2.44E-01
Cardioembolic stroke 8B11.20 Whole blood 7.33E-01 -3.15E-03 -1.39E-02
Cervical cancer 2C77 Cervical tissue 5.83E-01 6.55E-02 2.51E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.93E-01 4.31E-02 1.51E-01
Chronic hepatitis C 1E51.1 Whole blood 5.47E-01 2.28E-02 1.45E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.25E-01 -1.27E-01 -2.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.41E-05 2.93E-01 9.37E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.63E-01 4.53E-02 2.46E-01
Colon cancer 2B90 Colon tissue 6.01E-17 -3.61E-01 -8.19E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.44E-01 -3.12E-02 -2.08E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.06E-01 -9.31E-02 -5.07E-01
Endometriosis GA10 Endometrium tissue 1.30E-02 -3.15E-01 -6.06E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.37E-02 1.11E-01 1.11E+00
Familial hypercholesterolemia 5C80.00 Whole blood 2.66E-01 -1.50E-01 -6.75E-01
Gastric cancer 2B72 Gastric tissue 9.58E-01 -1.22E-01 -4.02E-01
Glioblastopma 2A00.00 Nervous tissue 8.07E-73 -3.77E-01 -1.33E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.09E-01 4.46E-02 7.59E-02
Head and neck cancer 2D42 Head and neck tissue 8.68E-01 6.96E-04 3.16E-03
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.85E-01 -1.68E-01 -6.47E-01
Huntington's disease 8A01.10 Whole blood 9.18E-01 -2.18E-02 -2.73E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.15E-03 -1.60E+00 -3.05E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.69E-01 3.84E-03 4.23E-02
Influenza 1.00E+30 Whole blood 7.22E-01 2.61E-01 3.12E-01
Interstitial cystitis GC00.3 Bladder tissue 2.23E-02 1.75E-01 1.64E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.36E-01 -6.99E-02 -2.58E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.72E-01 2.30E-02 1.08E-01
Ischemic stroke 8B11 Peripheral blood 5.84E-01 7.40E-02 4.74E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.85E-08 2.41E-01 7.15E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.55E-01 -7.36E-02 -6.38E-01
Lateral sclerosis 8B60.4 Skin 2.95E-01 2.17E-01 8.46E-01
Liver cancer 2C12.0 Liver tissue 4.32E-05 -3.37E-01 -6.16E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.63E-03 -2.37E-01 -1.34E+00
Lung cancer 2C25 Lung tissue 4.86E-88 -1.79E+00 -2.89E+00
Lupus erythematosus 4A40 Whole blood 5.29E-02 1.33E-01 2.28E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.17E-01 -2.61E-02 -1.21E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.32E-01 -4.07E-02 -2.57E-01
Melanoma 2C30 Skin 2.34E-02 -4.86E-01 -8.91E-01
Multiple myeloma 2A83.1 Bone marrow 5.06E-01 -2.67E-02 -7.76E-02
Multiple myeloma 2A83.1 Peripheral blood 8.54E-01 3.61E-02 1.64E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.83E-02 3.86E-01 9.69E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.46E-01 -6.54E-02 -3.35E-01
Myelofibrosis 2A20.2 Whole blood 1.48E-02 2.37E-01 1.97E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.43E-01 -1.26E-01 -1.41E-01
Myopathy 8C70.6 Muscle tissue 9.49E-01 -1.64E-02 -9.59E-02
Neonatal sepsis KA60 Whole blood 4.04E-08 1.42E-01 5.33E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.17E-02 -1.46E-01 -7.28E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.80E-01 5.15E-03 2.17E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.34E-03 -3.41E-01 -1.90E+00
Olive pollen allergy CA08.00 Peripheral blood 6.20E-01 1.68E-01 6.72E-01
Oral cancer 2B6E Oral tissue 6.59E-03 -1.64E-01 -3.96E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.16E-01 -2.01E-01 -6.39E-01
Osteoporosis FB83.1 Bone marrow 9.75E-01 1.07E-01 2.80E-01
Ovarian cancer 2C73 Ovarian tissue 7.12E-01 9.81E-03 4.06E-02
Pancreatic cancer 2C10 Pancreas 6.99E-04 -7.10E-01 -1.26E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.62E-01 6.11E-02 3.09E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.22E-01 6.73E-02 3.98E-01
Pituitary cancer 2D12 Pituitary tissue 1.24E-01 1.54E-01 6.31E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.01E-01 2.48E-01 8.05E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.51E-03 -8.87E-02 -7.14E-01
Polycythemia vera 2A20.4 Whole blood 2.85E-01 -8.57E-03 -8.22E-02
Pompe disease 5C51.3 Biceps muscle 2.02E-01 1.06E-01 6.72E-01
Preterm birth KA21.4Z Myometrium 6.57E-01 6.47E-03 6.26E-02
Prostate cancer 2C82 Prostate 3.50E-03 8.72E-01 8.91E-01
Psoriasis EA90 Skin 3.64E-09 2.33E-01 6.71E-01
Rectal cancer 2B92 Rectal colon tissue 9.95E-01 -1.45E-01 -4.95E-01
Renal cancer 2C90-2C91 Kidney 5.69E-02 -2.23E-01 -5.54E-01
Retinoblastoma 2D02.2 Uvea 1.24E-02 -1.30E-01 -1.64E+00
Rheumatoid arthritis FA20 Synovial tissue 5.22E-02 -1.04E-01 -3.90E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.29E-01 -1.42E-02 -1.06E-01
Schizophrenia 6A20 Prefrontal cortex 8.53E-01 2.25E-02 8.13E-02
Schizophrenia 6A20 Superior temporal cortex 1.05E-01 -7.54E-02 -3.97E-01
Scleroderma 4A42.Z Whole blood 7.06E-02 -1.88E-01 -1.32E+00
Seizure 8A60-8A6Z Whole blood 8.73E-01 3.35E-02 1.29E-01
Sensitive skin EK0Z Skin 8.49E-01 -1.05E-01 -5.30E-01
Sepsis with septic shock 1G41 Whole blood 1.51E-07 7.60E-02 2.57E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.72E-02 -1.79E-01 -1.21E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.42E-01 -2.09E-02 -1.03E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.66E-01 -2.56E-02 -1.81E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.34E-01 4.67E-02 2.32E-01
Skin cancer 2C30-2C3Z Skin 1.66E-04 6.90E-02 1.41E-01
Thrombocythemia 3B63 Whole blood 1.05E-01 -4.46E-02 -3.59E-01
Thrombocytopenia 3B64 Whole blood 7.32E-01 -4.10E-02 -7.71E-02
Thyroid cancer 2D10 Thyroid 7.36E-02 4.18E-02 1.85E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.47E-01 3.42E-02 1.57E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.36E-01 -3.02E-02 -2.91E-01
Type 2 diabetes 5A11 Liver tissue 4.07E-03 -1.90E-01 -2.48E+00
Ureter cancer 2C92 Urothelium 3.81E-01 7.56E-02 5.63E-01
Uterine cancer 2C78 Endometrium tissue 5.71E-08 -2.34E-01 -4.95E-01
Vitiligo ED63.0 Skin 7.72E-01 -9.28E-02 -2.12E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Zinc transporters ZnT1 (Slc30a1), Zip8 (Slc39a8), and Zip10 (Slc39a10) in mouse red blood cells are differentially regulated during erythroid development and by dietary zinc deficiency. J Nutr. 2008 Nov;138(11):2076-83.