Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTLX28N)

DTP Name Sodium-coupled neutral amino acid transporter 5 (SLC38A5)
Gene Name SLC38A5
UniProt ID
Q8WUX1 (S38A5_HUMAN)
VARIDT ID
DTD0332
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms JM24; SLC38A5; SN2; SNAT5; Solute carrier family 38 member 5; System N transporter 2; pp7194
DTP Family Amino Acid/Auxin Permease (AAAP) Family ;
Tissue Specificity Predominantly expressed in stomach, brain,liver, lung and intestinal tract.
Sequence
MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKTSFGMSVFNLSNA
IMGSGILGLAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCAGIAGIRAYEQLGQRAFG
PAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGTFLYMDPEGDWFLKGNLLIIIVSVL
IILPLALMKHLGYLGYTSGLSLTCMLFFLVSVIYKKFQLGCAIGHNETAMESEALVGLPS
QGLNSSCEAQMFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCRPSKRRMQAVANVSIGA
MFCMYGLTATFGYLTFYSSVKAEMLHMYSQKDPLILCVRLAVLLAVTLTVPVVLFPIRRA
LQQLLFPGKAFSWPRHVAIALILLVLVNVLVICVPTIRDIFGVIGSTSAPSLIFILPSIF
YLRIVPSEVEPFLSWPKIQALCFGVLGVLFMAVSLGFMFANWATGQSRMSGH
Function
This transporter functions as a sodium-dependent amino acid transporter and mediates the saturable, pH-sensitive, and electrogenic cotransport of several neutral amino acids including glycine, asparagine, alanine, serine, glutamine and histidine with sodium.
Endogenous Substrate(s) Glycine; Asparagine; Alanine; Serine; Glutamine; Histidine
TCDB ID
2.A.18.6.15
Gene ID
92745
KEGG Pathway
GABAergic synapse (hsa04727 )
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Alanine DMZDN4W Dietary shortage 5B5K Approved [2]
L-glutamine DM69G8X Short bowel syndrome KB89.1 Approved [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.33E-15 -6.83E-01 -9.93E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.17E-01 5.85E-03 2.41E-02
Alopecia ED70 Skin from scalp 1.06E-01 -1.32E-01 -3.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.90E-02 -2.00E-01 -5.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.00E-01 -6.78E-02 -6.00E-01
Aortic stenosis BB70 Calcified aortic valve 4.09E-01 1.45E-01 3.96E-01
Apnea 7A40 Hyperplastic tonsil 1.23E-04 -1.19E+00 -5.09E+00
Arthropathy FA00-FA5Z Peripheral blood 6.33E-01 -2.42E-02 -3.24E-02
Asthma CA23 Nasal and bronchial airway 2.15E-03 -2.35E-01 -4.58E-01
Atopic dermatitis EA80 Skin 5.63E-15 8.80E-01 4.63E+00
Autism 6A02 Whole blood 1.96E-01 -2.63E-01 -6.08E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.31E-02 -1.84E-01 -8.48E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.29E-01 -1.33E-01 -9.88E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.48E-17 5.49E-01 1.31E+00
Batten disease 5C56.1 Whole blood 8.88E-01 -1.32E-02 -1.56E-01
Behcet's disease 4A62 Peripheral blood 7.77E-01 2.66E-03 1.27E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.58E-01 -7.42E-02 -3.39E-01
Bladder cancer 2C94 Bladder tissue 1.40E-02 2.73E-01 7.75E-01
Breast cancer 2C60-2C6Z Breast tissue 7.48E-87 5.17E-01 1.69E+00
Cardioembolic stroke 8B11.20 Whole blood 2.82E-06 -1.60E+00 -1.72E+00
Cervical cancer 2C77 Cervical tissue 8.94E-02 1.09E-01 2.62E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.03E-01 4.51E-02 1.25E-01
Chronic hepatitis C 1E51.1 Whole blood 2.14E-01 -1.13E-01 -4.05E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.84E-01 -5.79E-02 -1.40E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.59E-01 3.59E-02 1.14E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.10E-01 4.21E-01 2.70E+00
Colon cancer 2B90 Colon tissue 1.07E-66 1.41E+00 2.89E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.02E-01 -3.09E-01 -7.90E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.91E-01 2.58E-01 3.48E-01
Endometriosis GA10 Endometrium tissue 6.64E-01 -2.72E-01 -4.53E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.14E-01 -8.87E-02 -4.87E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.45E-08 -1.82E+00 -1.83E+00
Gastric cancer 2B72 Gastric tissue 7.85E-01 -6.12E-01 -8.92E-01
Glioblastopma 2A00.00 Nervous tissue 9.21E-18 3.16E-01 5.24E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.89E-03 -2.82E-01 -9.82E-01
Head and neck cancer 2D42 Head and neck tissue 4.19E-33 1.44E+00 2.61E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.81E-02 7.26E-02 2.82E-01
Huntington's disease 8A01.10 Whole blood 2.89E-01 -1.52E-01 -4.22E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.82E-01 2.27E-01 4.78E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.15E-03 2.05E-01 1.20E+00
Influenza 1.00E+30 Whole blood 8.67E-02 1.05E+00 1.39E+00
Interstitial cystitis GC00.3 Bladder tissue 2.55E-02 7.70E-01 1.50E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.39E-03 8.92E-01 3.24E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.82E-01 -2.36E-02 -8.04E-02
Ischemic stroke 8B11 Peripheral blood 3.60E-01 1.21E-02 3.84E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.67E-03 4.90E-02 1.17E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.25E-02 -1.26E-01 -3.57E-01
Lateral sclerosis 8B60.4 Skin 8.43E-01 6.76E-02 3.38E-01
Liver cancer 2C12.0 Liver tissue 7.51E-02 -4.85E-02 -1.53E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.85E-06 1.07E+00 4.05E+00
Lung cancer 2C25 Lung tissue 1.96E-34 -7.00E-01 -1.56E+00
Lupus erythematosus 4A40 Whole blood 1.51E-03 -2.63E-01 -2.25E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.66E-02 6.64E-02 1.81E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.29E-01 6.83E-03 3.12E-02
Melanoma 2C30 Skin 5.74E-01 -2.08E-01 -2.10E-01
Multiple myeloma 2A83.1 Bone marrow 4.15E-03 6.05E-01 1.43E+00
Multiple myeloma 2A83.1 Peripheral blood 7.18E-01 -3.35E-01 -4.61E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.05E-01 1.01E-01 3.26E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.72E-02 -6.14E-02 -1.41E-01
Myelofibrosis 2A20.2 Whole blood 1.95E-02 3.70E-01 9.10E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.73E-01 4.31E-02 4.50E-02
Myopathy 8C70.6 Muscle tissue 3.55E-01 1.48E-01 8.54E-01
Neonatal sepsis KA60 Whole blood 6.13E-02 -7.10E-02 -1.34E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.22E-01 4.68E-02 1.62E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.85E-01 3.39E-02 1.33E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.79E-01 -1.41E-01 -5.03E-01
Olive pollen allergy CA08.00 Peripheral blood 6.43E-01 3.30E-01 5.19E-01
Oral cancer 2B6E Oral tissue 2.38E-03 4.35E-01 5.37E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.91E-01 1.62E-01 1.80E-01
Osteoporosis FB83.1 Bone marrow 9.06E-01 2.00E-01 4.64E-01
Ovarian cancer 2C73 Ovarian tissue 6.89E-01 -1.96E-01 -3.47E-01
Pancreatic cancer 2C10 Pancreas 1.99E-01 -6.41E-01 -4.24E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.65E-01 -3.02E-01 -7.97E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.40E-03 2.18E-01 7.67E-01
Pituitary cancer 2D12 Pituitary tissue 8.79E-01 2.88E-02 9.51E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.69E-01 -1.46E-02 -4.63E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.41E-01 3.27E-02 2.09E-01
Polycythemia vera 2A20.4 Whole blood 6.22E-07 5.99E-01 1.43E+00
Pompe disease 5C51.3 Biceps muscle 4.25E-03 -1.31E-01 -1.07E+00
Preterm birth KA21.4Z Myometrium 8.23E-02 -4.51E-01 -4.43E-01
Prostate cancer 2C82 Prostate 7.03E-05 -6.90E-01 -1.33E+00
Psoriasis EA90 Skin 8.25E-02 -1.45E-01 -2.35E-01
Rectal cancer 2B92 Rectal colon tissue 4.17E-05 1.65E+00 3.85E+00
Renal cancer 2C90-2C91 Kidney 1.45E-01 -1.97E-01 -8.60E-01
Retinoblastoma 2D02.2 Uvea 6.33E-01 -3.41E-01 -1.11E+00
Rheumatoid arthritis FA20 Synovial tissue 7.62E-04 8.83E-01 2.09E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.22E-02 -2.49E-03 -1.19E-02
Schizophrenia 6A20 Prefrontal cortex 1.42E-04 -1.54E-01 -4.97E-01
Schizophrenia 6A20 Superior temporal cortex 2.67E-03 -2.48E-01 -9.45E-01
Scleroderma 4A42.Z Whole blood 4.22E-02 -2.79E-01 -4.88E-01
Seizure 8A60-8A6Z Whole blood 1.99E-01 -2.35E-01 -5.06E-01
Sensitive skin EK0Z Skin 7.13E-02 3.41E-01 1.45E+00
Sepsis with septic shock 1G41 Whole blood 3.36E-06 -3.19E-01 -6.02E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.55E-01 1.06E-01 2.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.04E-02 1.68E-01 6.77E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.76E-02 5.09E-01 1.48E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.86E-01 -3.01E-01 -1.42E+00
Skin cancer 2C30-2C3Z Skin 2.18E-15 -9.74E-01 -1.31E+00
Thrombocythemia 3B63 Whole blood 3.83E-03 2.77E-01 6.76E-01
Thrombocytopenia 3B64 Whole blood 3.97E-01 2.38E-01 3.86E-01
Thyroid cancer 2D10 Thyroid 7.72E-01 1.38E-01 2.63E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.52E-04 -2.49E-01 -1.32E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.94E-01 -1.37E-02 -2.67E-02
Type 2 diabetes 5A11 Liver tissue 8.73E-01 -6.65E-02 -2.77E-01
Ureter cancer 2C92 Urothelium 2.28E-02 1.26E-01 1.27E+00
Uterine cancer 2C78 Endometrium tissue 4.14E-25 -1.29E+00 -1.66E+00
Vitiligo ED63.0 Skin 6.61E-01 -1.39E-01 -2.29E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 38 member 5 (SLC38A5) DTT Info
DTP DTT Type Literature-reported
2 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
[14C]histidine DMVUF71 Discovery agent N.A. Investigative [1]
[3H]histidine DMJ5BDQ N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1173).
2 Identification of SLC38A7 (SNAT7) protein as a glutamine transporter expressed in neurons. J Biol Chem. 2011 Jun 10;286(23):20500-11.