Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTM301H)

DTP Name Sodium-coupled monocarboxylate transporter 2 (SLC5A12)
Gene Name SLC5A12
UniProt ID
Q1EHB4 (SC5AC_HUMAN)
VARIDT ID
DTD0421
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Electroneutral sodium monocarboxylate cotransporter; Low-affinity sodium-lactate cotransporter; SLC5A12; SMCT2; Solute carrier family 5 member 12
DTP Family Solute:Sodium Symporter (SSS) Family ;
Sequence
MEVKNFAVWDYVVFAALFFISSGIGVFFAIKERKKATSREFLVGGRQMSFGPVGLSLTAS
FMSAVTVLGTPSEVYRFGASFLVFFIAYLFVILLTSELFLPVFYRSGITSTYEYLQLRFN
KPVRYAATVIYIVQTILYTGVVVYAPALALNQVTGFDLWGSVFATGIVCTFYCTLGGLKA
VVWTDAFQMVVMIVGFLTVLIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWT
ITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNLLGLWIILVCAVFSGLIMYSH
FKDCDPWTSGIISAPDQLMPYFVMEIFATMPGLPGLFVACAFSGTLSTVASSINALATVT
FEDFVKSCFPHLSDKLSTWISKGLCLLFGVMCTSMAVAASVMGGVVQASLSIHGMCGGPM
LGLFSLGIVFPFVNWKGALGGLLTGITLSFWVAIGAFIYPAPASKTWPLPLSTDQCIKSN
VTATGPPVLSSRPGIADTWYSISYLYYSAVGCLGCIVAGVIISLITGRQRGEDIQPLLIR
PVCNLFCFWSKKYKTLCWCGVQHDSGTEQENLENGSARKQGAESVLQNGLRRESLVHVPG
YDPKDKSYNNMAFETTHF
Function This transporter mediates the reabsorption of lactate in the initial part of the proximal tubule.
Endogenous Substrate(s) Monocarboxylates; Na+
TCDB ID
2.A.21.5.6
Gene ID
159963
Reactome Pathway
Multifunctional anion exchangers (R-HSA-427601 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
3 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Benzoic Acid DMKB9FI Alopecia areata ED70.2 Approved [1]
Gamma Hydroxybutyric Acid DMGBKVD Narcolepsy 7A20 Approved [1]
Salicyclic acid DM2F8XZ Acne vulgaris ED80 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.69E-03 -4.19E-02 -3.67E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.80E-01 1.85E-02 2.77E-01
Alopecia ED70 Skin from scalp 6.77E-01 1.03E-02 6.26E-02
Alzheimer's disease 8A20 Entorhinal cortex 3.54E-01 5.45E-03 5.29E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 9.01E-01 -3.22E-02 -3.64E-01
Aortic stenosis BB70 Calcified aortic valve 4.07E-01 8.24E-02 5.16E-01
Apnea 7A40 Hyperplastic tonsil 9.34E-01 2.42E-02 2.85E-01
Arthropathy FA00-FA5Z Peripheral blood 2.37E-01 2.91E-02 3.33E-01
Asthma CA23 Nasal and bronchial airway 1.08E-05 4.32E-01 6.76E-01
Atopic dermatitis EA80 Skin 8.48E-01 5.64E-02 3.59E-01
Autism 6A02 Whole blood 6.92E-01 -9.10E-04 -7.55E-03
Autoimmune uveitis 9A96 Peripheral monocyte 1.07E-01 -5.21E-02 -4.99E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.56E-01 -1.25E-02 -1.49E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.48E-01 8.15E-03 7.78E-02
Batten disease 5C56.1 Whole blood 2.24E-03 1.81E-01 3.49E+00
Behcet's disease 4A62 Peripheral blood 4.86E-01 7.61E-03 6.49E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.25E-01 1.00E-02 1.19E-01
Bladder cancer 2C94 Bladder tissue 4.51E-02 7.37E-02 7.64E-01
Breast cancer 2C60-2C6Z Breast tissue 4.83E-01 -5.72E-03 -4.19E-02
Cardioembolic stroke 8B11.20 Whole blood 1.02E-02 -1.69E-01 -6.40E-01
Cervical cancer 2C77 Cervical tissue 8.50E-01 -5.66E-02 -4.46E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.18E-01 1.05E-02 7.54E-02
Chronic hepatitis C 1E51.1 Whole blood 6.79E-01 0.00E+00 0.00E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 2.45E-01 -1.86E-02 -1.75E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.16E-01 2.05E-02 2.17E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.50E-01 -4.46E-03 -1.22E-01
Colon cancer 2B90 Colon tissue 7.20E-01 8.13E-03 1.86E-02
Coronary artery disease BA80-BA8Z Peripheral blood 2.47E-01 -1.08E-01 -1.09E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.94E-01 -2.05E-02 -1.58E-01
Endometriosis GA10 Endometrium tissue 2.06E-01 -4.07E-02 -2.79E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.21E-01 5.80E-02 8.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.71E-02 -6.93E-02 -4.97E-01
Gastric cancer 2B72 Gastric tissue 6.61E-01 2.13E-02 9.63E-02
Glioblastopma 2A00.00 Nervous tissue 3.34E-01 -1.84E-02 -1.29E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.20E-01 -1.32E-01 -6.15E-01
Head and neck cancer 2D42 Head and neck tissue 1.48E-03 4.27E-02 3.91E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.98E-02 -4.85E-02 -4.92E-01
Huntington's disease 8A01.10 Whole blood 5.66E-01 5.03E-02 3.23E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.34E-01 -5.98E-02 -7.32E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.47E-01 -7.16E-03 -1.25E-01
Influenza 1.00E+30 Whole blood 5.52E-03 1.97E-01 2.78E+00
Interstitial cystitis GC00.3 Bladder tissue 3.02E-01 -2.96E-02 -4.66E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.36E-03 1.28E-01 1.10E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.05E-01 3.09E-02 8.22E-02
Ischemic stroke 8B11 Peripheral blood 8.41E-01 -1.10E-02 -1.04E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.60E-02 4.33E-02 2.45E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.61E-01 1.14E-02 1.14E-01
Lateral sclerosis 8B60.4 Skin 3.58E-01 -7.11E-02 -6.82E-01
Liver cancer 2C12.0 Liver tissue 1.57E-02 -6.36E-02 -3.34E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.22E-01 -7.03E-02 -4.00E-01
Lung cancer 2C25 Lung tissue 6.82E-24 1.02E-01 8.53E-01
Lupus erythematosus 4A40 Whole blood 1.98E-10 1.22E-01 6.53E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.02E-01 -5.90E-03 -2.70E-02
Major depressive disorder 6A70-6A7Z Hippocampus 4.49E-01 4.91E-02 5.45E-01
Melanoma 2C30 Skin 3.02E-01 -6.46E-02 -2.39E-01
Multiple myeloma 2A83.1 Bone marrow 4.19E-01 -3.77E-02 -2.69E-01
Multiple myeloma 2A83.1 Peripheral blood 4.72E-01 -1.98E-02 -3.44E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.52E-01 -1.60E-01 -3.99E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.45E-02 4.29E-02 4.62E-01
Myelofibrosis 2A20.2 Whole blood 7.42E-01 3.18E-03 2.27E-02
Myocardial infarction BA41-BA50 Peripheral blood 5.58E-02 1.79E-01 3.37E-01
Myopathy 8C70.6 Muscle tissue 5.06E-01 -7.58E-03 -9.73E-02
Neonatal sepsis KA60 Whole blood 2.73E-01 -5.13E-02 -4.28E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.79E-01 -5.61E-02 -6.53E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.26E-01 -5.83E-03 -6.33E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.85E-03 2.09E-01 2.65E+00
Olive pollen allergy CA08.00 Peripheral blood 4.32E-02 4.69E-02 8.59E-01
Oral cancer 2B6E Oral tissue 5.37E-03 7.12E-02 5.66E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.00E-01 -1.22E-02 -9.15E-02
Osteoporosis FB83.1 Bone marrow 6.31E-01 6.64E-02 2.93E-01
Ovarian cancer 2C73 Ovarian tissue 6.55E-01 -4.34E-02 -2.54E-01
Pancreatic cancer 2C10 Pancreas 3.43E-01 -2.93E-02 -1.78E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.07E-02 -6.66E-02 -7.18E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.29E-01 2.37E-02 3.41E-01
Pituitary cancer 2D12 Pituitary tissue 2.24E-01 8.95E-02 7.87E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.15E-01 9.46E-02 8.33E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.34E-01 -2.99E-02 -3.64E-01
Polycythemia vera 2A20.4 Whole blood 1.40E-03 6.32E-02 5.02E-01
Pompe disease 5C51.3 Biceps muscle 8.16E-02 -4.29E-02 -3.38E-01
Preterm birth KA21.4Z Myometrium 4.55E-01 9.05E-02 8.56E-01
Prostate cancer 2C82 Prostate 7.36E-01 3.12E-02 5.37E-02
Psoriasis EA90 Skin 6.48E-02 -3.50E-02 -2.21E-01
Rectal cancer 2B92 Rectal colon tissue 3.39E-01 -8.91E-02 -7.15E-01
Renal cancer 2C90-2C91 Kidney 6.68E-02 -2.23E+00 -1.02E+00
Retinoblastoma 2D02.2 Uvea 1.03E-03 1.19E-01 1.48E+00
Rheumatoid arthritis FA20 Synovial tissue 6.97E-04 -2.47E-01 -2.46E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.10E-01 -1.05E-02 -1.22E-01
Schizophrenia 6A20 Prefrontal cortex 2.97E-01 -1.89E-02 -1.96E-01
Schizophrenia 6A20 Superior temporal cortex 9.85E-01 -3.90E-03 -7.69E-02
Scleroderma 4A42.Z Whole blood 1.03E-05 1.27E-01 2.27E+00
Seizure 8A60-8A6Z Whole blood 3.67E-01 -5.04E-02 -3.73E-01
Sensitive skin EK0Z Skin 2.45E-01 -9.09E-02 -5.42E-01
Sepsis with septic shock 1G41 Whole blood 8.06E-03 -4.57E-02 -3.48E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.53E-02 6.62E-02 9.08E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.66E-01 1.08E-01 9.47E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.69E-02 8.73E-02 2.28E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.56E-01 -1.30E-01 -1.11E+00
Skin cancer 2C30-2C3Z Skin 1.33E-06 3.29E-02 2.07E-01
Thrombocythemia 3B63 Whole blood 3.13E-01 9.27E-02 6.10E-01
Thrombocytopenia 3B64 Whole blood 2.37E-01 1.41E-01 1.25E+00
Thyroid cancer 2D10 Thyroid 9.17E-01 6.14E-03 4.84E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.10E-01 -3.40E-02 -3.43E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.22E-02 8.82E-02 1.84E+00
Type 2 diabetes 5A11 Liver tissue 9.68E-01 1.51E-01 4.01E-01
Ureter cancer 2C92 Urothelium 5.63E-01 8.66E-04 8.17E-03
Uterine cancer 2C78 Endometrium tissue 2.14E-02 1.60E-02 1.06E-01
Vitiligo ED63.0 Skin 1.87E-02 9.62E-02 1.24E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Sodium-coupled monocarboxylate transporters in normal tissues and in cancer. AAPS J. 2008;10(1):193-9.