General Information of Drug Transporter (DTP) (ID: DTNMR1V)

DTP Name Sodium-dependent neutral amino acid transporter B(0)AT2 (SLC6A15)
Gene Name SLC6A15
UniProt ID
Q9H2J7 (S6A15_HUMAN)
VARIDT ID
DTD0447
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
Sodium- and chloride-dependent neurotransmitter transporter NTT73; Sodium-coupled branched-chain amino-acid transporter 1; Solute carrier family 6 member 15; Transporter v7-3; SLC6A15; B0AT2; NTT73; SBAT1
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Almost exclusively expressed in the brain.
Sequence
MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDE
RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELS
VGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWD
QCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMTICLLAAWVMVC
LAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPKLEIMLEPKVWR
EAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKA
NVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPA
LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIE
GIVTPIVDTFKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILE
NIAVCFVYGIDKFMEDLKDMLGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYN
AWIEDKASEEFLSYPTWGLVVCVSLVVFAILPVPVVFIVRRFNLIDDSSGNLASVTYKRG
RVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMAD
IMPDMPESDL
Function This transporter is a sodium-dependent neutral amino acid transporter. And it exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine.
Endogenous Substrate(s) Na+, Neutral amino acids
TCDB ID
2.A.22.6.7
Gene ID
55117
Reactome Pathway
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )
Amino acid transport across the plasma membrane (R-HSA-352230 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.11E-01 1.29E-02 9.93E-02
Adrenocortical carcinoma 2D11.Z Kidney 8.82E-01 4.04E-03 3.84E-02
Alopecia ED70 Skin from scalp 1.45E-02 -1.96E-01 -6.20E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.87E-01 1.13E-02 2.88E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 5.81E-01 4.79E-02 3.49E-01
Aortic stenosis BB70 Calcified aortic valve 3.38E-01 1.45E-01 5.18E-01
Apnea 7A40 Hyperplastic tonsil 1.62E-01 -3.86E-01 -6.88E-01
Arthropathy FA00-FA5Z Peripheral blood 1.81E-01 6.54E-03 1.02E-01
Asthma CA23 Nasal and bronchial airway 7.20E-03 6.47E-02 1.62E-01
Atopic dermatitis EA80 Skin 3.39E-01 -7.73E-03 -4.09E-02
Autism 6A02 Whole blood 3.69E-01 -3.16E-02 -2.36E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.04E-01 -2.99E-02 -1.78E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.12E-01 -2.81E-02 -2.80E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.43E-04 -8.26E-02 -3.92E-01
Batten disease 5C56.1 Whole blood 6.13E-01 3.66E-02 5.23E-01
Behcet's disease 4A62 Peripheral blood 8.79E-02 1.03E-01 1.08E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.18E-01 -2.76E-02 -8.50E-02
Bladder cancer 2C94 Bladder tissue 4.21E-05 4.49E-01 1.96E+00
Breast cancer 2C60-2C6Z Breast tissue 1.43E-01 -9.74E-02 -5.40E-01
Cardioembolic stroke 8B11.20 Whole blood 5.60E-01 -1.38E-02 -1.29E-01
Cervical cancer 2C77 Cervical tissue 2.15E-01 -2.75E-01 -9.35E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.48E-01 -3.80E-03 -3.70E-02
Chronic hepatitis C 1E51.1 Whole blood 3.98E-01 9.38E-03 7.63E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 2.78E-01 5.52E-02 4.97E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.23E-01 8.42E-03 6.60E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.02E-01 -2.53E-02 -2.31E-01
Colon cancer 2B90 Colon tissue 4.10E-01 -3.85E-02 -2.65E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.91E-01 -8.08E-02 -7.47E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.76E-01 -5.07E-02 -2.88E-01
Endometriosis GA10 Endometrium tissue 2.94E-01 4.45E-02 2.58E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.39E-01 -1.67E-03 -1.12E-02
Familial hypercholesterolemia 5C80.00 Whole blood 5.10E-02 -1.16E-01 -6.99E-01
Gastric cancer 2B72 Gastric tissue 2.57E-01 -8.26E-02 -2.46E+00
Glioblastopma 2A00.00 Nervous tissue 5.46E-23 -7.12E-01 -1.28E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.88E-02 -1.11E+00 -6.62E-01
Head and neck cancer 2D42 Head and neck tissue 2.90E-16 2.93E-01 2.01E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.93E-01 1.20E-01 3.64E-01
Huntington's disease 8A01.10 Whole blood 9.28E-02 -6.25E-02 -7.96E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.86E-01 -1.05E-01 -6.64E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.71E-01 6.47E-02 3.71E-01
Influenza 1.00E+30 Whole blood 4.03E-01 1.16E-01 1.05E+00
Interstitial cystitis GC00.3 Bladder tissue 8.35E-01 -2.90E-02 -4.06E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.04E-02 -7.97E-02 -9.36E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.54E-01 1.13E-01 2.97E-01
Ischemic stroke 8B11 Peripheral blood 6.51E-01 -6.65E-03 -5.13E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 6.92E-02 7.81E-02 2.64E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.95E-01 1.95E-03 1.12E-02
Lateral sclerosis 8B60.4 Skin 4.71E-01 3.41E-01 6.00E-01
Liver cancer 2C12.0 Liver tissue 8.90E-01 -3.65E-02 -3.31E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.50E-01 -8.73E-03 -7.28E-02
Lung cancer 2C25 Lung tissue 2.34E-48 9.76E-02 7.97E-01
Lupus erythematosus 4A40 Whole blood 9.81E-01 -2.57E-02 -9.36E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.87E-01 2.86E-02 1.07E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.03E-01 2.98E-02 9.33E-02
Melanoma 2C30 Skin 7.46E-09 1.16E+00 1.72E+00
Multiple myeloma 2A83.1 Bone marrow 8.42E-03 -2.10E-01 -1.10E+00
Multiple myeloma 2A83.1 Peripheral blood 1.42E-01 -1.17E-02 -9.99E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.70E-01 -2.65E-02 -2.01E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.76E-02 -7.86E-04 -8.43E-03
Myelofibrosis 2A20.2 Whole blood 6.32E-02 -5.03E-02 -4.79E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.07E-02 9.45E-02 2.62E-01
Myopathy 8C70.6 Muscle tissue 3.70E-01 -1.94E-02 -1.62E-01
Neonatal sepsis KA60 Whole blood 4.90E-02 1.40E-02 1.09E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.05E-02 -4.35E-01 -1.54E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.40E-01 -6.76E-02 -6.48E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.24E-01 -5.80E-03 -1.70E-01
Olive pollen allergy CA08.00 Peripheral blood 5.97E-01 1.16E-01 9.17E-01
Oral cancer 2B6E Oral tissue 7.81E-08 5.40E-01 1.34E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.44E-01 -5.94E-02 -3.65E-01
Osteoporosis FB83.1 Bone marrow 6.08E-01 1.06E-01 1.67E-01
Ovarian cancer 2C73 Ovarian tissue 2.39E-01 -8.01E-02 -3.77E-01
Pancreatic cancer 2C10 Pancreas 7.08E-03 -2.03E-01 -8.25E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.85E-01 -2.35E-01 -3.49E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.41E-01 1.19E-02 1.16E-01
Pituitary cancer 2D12 Pituitary tissue 1.12E-03 -1.55E+00 -2.83E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.33E-07 -1.90E+00 -4.36E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.23E-01 -8.09E-02 -4.42E-01
Polycythemia vera 2A20.4 Whole blood 1.03E-02 -5.39E-02 -4.81E-01
Pompe disease 5C51.3 Biceps muscle 9.51E-02 -1.42E-02 -1.36E-01
Preterm birth KA21.4Z Myometrium 9.22E-01 3.98E-02 3.67E-01
Prostate cancer 2C82 Prostate 2.47E-01 -9.70E-02 -2.47E-01
Psoriasis EA90 Skin 2.56E-16 2.58E-01 1.19E+00
Rectal cancer 2B92 Rectal colon tissue 1.53E-01 -1.26E-01 -7.35E-01
Renal cancer 2C90-2C91 Kidney 5.83E-01 -4.77E-02 -1.98E-01
Retinoblastoma 2D02.2 Uvea 1.16E-02 5.48E-01 2.64E+00
Rheumatoid arthritis FA20 Synovial tissue 3.07E-01 -1.97E-02 -9.54E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.18E-01 1.88E-02 1.80E-01
Schizophrenia 6A20 Prefrontal cortex 3.69E-02 -2.49E-01 -4.38E-01
Schizophrenia 6A20 Superior temporal cortex 6.95E-02 -8.01E-02 -5.60E-01
Scleroderma 4A42.Z Whole blood 3.31E-02 6.54E-02 5.40E-01
Seizure 8A60-8A6Z Whole blood 1.92E-01 -4.74E-02 -3.46E-01
Sensitive skin EK0Z Skin 4.94E-01 2.51E-03 1.67E-02
Sepsis with septic shock 1G41 Whole blood 3.30E-07 2.19E-02 1.77E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.42E-01 2.16E-01 1.02E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.58E-01 -3.61E-02 -2.96E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.06E-01 -6.83E-02 -8.65E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.92E-01 8.85E-02 1.21E+00
Skin cancer 2C30-2C3Z Skin 3.27E-80 1.74E+00 6.61E+00
Thrombocythemia 3B63 Whole blood 5.66E-01 -4.53E-02 -4.13E-01
Thrombocytopenia 3B64 Whole blood 1.32E-01 9.23E-02 8.22E-01
Thyroid cancer 2D10 Thyroid 4.68E-01 -7.05E-02 -3.71E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.45E-01 -4.36E-02 -5.06E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.62E-01 2.69E-02 1.15E-01
Type 2 diabetes 5A11 Liver tissue 4.06E-01 4.31E-02 3.18E-01
Ureter cancer 2C92 Urothelium 1.43E-01 6.96E-02 4.59E-01
Uterine cancer 2C78 Endometrium tissue 1.64E-06 5.81E-02 2.19E-01
Vitiligo ED63.0 Skin 5.98E-02 -4.36E-01 -6.99E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name HUMAN solute carrier family 6 member 15 (SLC6A15) DTT Info