Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTNU9EW)

DTP Name Graves disease carrier protein (SLC25A16)
Gene Name SLC25A16
UniProt ID
P16260 (GDC_HUMAN)
VARIDT ID
DTD0175
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms D10S105E; GDA; GDC; Graves disease autoantigen; HGT.1; ML7; SLC25A16; Solute carrier family 25 member 16; hML7; Mitochondrial solute carrier protein homolog
DTP Family Mitochondrial Carrier (MC) Family ;
Sequence
MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRV
KVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTL
ITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYA
KEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKT
HVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL
YRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN
Function This transporter required for the accumulation of coenzyme A in the mitochondrial matrix.
TCDB ID
2.A.29.12.3
Gene ID
8034
Reactome Pathway
Coenzyme A biosynthesis (R-HSA-196783 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Coenzyme A DM1I8LU Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.39E-02 -1.04E-01 -4.08E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.19E-01 4.47E-03 2.95E-02
Alopecia ED70 Skin from scalp 4.46E-01 -3.75E-02 -1.10E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.73E-01 -1.68E-02 -1.03E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.19E-01 -1.21E-01 -4.08E-01
Aortic stenosis BB70 Calcified aortic valve 8.45E-02 3.27E-01 1.08E+00
Apnea 7A40 Hyperplastic tonsil 7.55E-01 4.55E-02 2.61E-01
Arthropathy FA00-FA5Z Peripheral blood 6.21E-01 -1.63E-02 -5.93E-02
Asthma CA23 Nasal and bronchial airway 2.94E-07 4.25E-01 6.79E-01
Atopic dermatitis EA80 Skin 8.72E-04 2.38E-01 8.39E-01
Autism 6A02 Whole blood 4.09E-01 1.67E-02 7.36E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.81E-03 5.76E-01 2.57E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.43E-02 3.61E-01 1.08E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.39E-02 -1.11E-01 -3.38E-01
Batten disease 5C56.1 Whole blood 3.94E-01 -1.84E-01 -1.45E+00
Behcet's disease 4A62 Peripheral blood 9.30E-01 -4.95E-02 -1.47E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.68E-01 -7.87E-02 -3.92E-01
Bladder cancer 2C94 Bladder tissue 1.42E-05 9.49E-02 1.45E+00
Breast cancer 2C60-2C6Z Breast tissue 2.13E-01 3.19E-01 3.20E-01
Cardioembolic stroke 8B11.20 Whole blood 2.09E-03 -1.98E-01 -6.35E-01
Cervical cancer 2C77 Cervical tissue 7.41E-01 -3.09E-02 -1.04E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.58E-02 -1.51E-01 -5.23E-01
Chronic hepatitis C 1E51.1 Whole blood 9.46E-01 -6.60E-03 -2.91E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 7.46E-01 -5.65E-03 -2.15E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.21E-02 1.39E-01 5.09E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.10E-01 2.35E-02 1.63E-01
Colon cancer 2B90 Colon tissue 2.63E-04 -1.88E-01 -4.65E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.47E-01 3.76E-02 7.38E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.54E-01 -2.76E-01 -4.98E-01
Endometriosis GA10 Endometrium tissue 4.06E-01 -4.06E-02 -7.13E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.97E-01 4.43E-02 2.34E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.07E-03 2.87E-01 1.23E+00
Gastric cancer 2B72 Gastric tissue 1.00E-01 4.57E-01 1.51E+00
Glioblastopma 2A00.00 Nervous tissue 1.93E-81 5.51E-01 1.47E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.67E-01 -1.15E-01 -1.21E-01
Head and neck cancer 2D42 Head and neck tissue 2.73E-13 3.44E-01 9.86E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.79E-01 -3.27E-02 -1.62E-01
Huntington's disease 8A01.10 Whole blood 7.67E-02 -4.95E-02 -1.80E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.28E-04 -6.57E-01 -2.92E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.12E-01 -9.56E-02 -3.63E-01
Influenza 1.00E+30 Whole blood 8.38E-02 -9.94E-01 -1.60E+00
Interstitial cystitis GC00.3 Bladder tissue 5.46E-01 2.49E-01 1.07E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.30E-01 -2.64E-01 -3.54E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.31E-01 8.31E-02 2.67E-01
Ischemic stroke 8B11 Peripheral blood 4.24E-01 -1.06E-01 -3.94E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.31E-01 -5.28E-02 -1.44E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.84E-01 -1.96E-01 -5.68E-01
Lateral sclerosis 8B60.4 Skin 2.13E-01 4.32E-01 1.09E+00
Liver cancer 2C12.0 Liver tissue 8.89E-01 2.02E-02 3.86E-02
Liver failure DB99.7-DB99.8 Liver tissue 3.67E-04 -1.29E+00 -2.85E+00
Lung cancer 2C25 Lung tissue 2.27E-25 3.78E-01 9.66E-01
Lupus erythematosus 4A40 Whole blood 4.28E-02 1.86E-01 2.70E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.46E-02 -9.41E-02 -2.55E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.44E-01 5.55E-02 2.63E-01
Melanoma 2C30 Skin 4.33E-01 -1.56E-01 -1.91E-01
Multiple myeloma 2A83.1 Bone marrow 1.07E-05 6.33E-01 3.54E+00
Multiple myeloma 2A83.1 Peripheral blood 6.64E-01 1.20E-02 2.97E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.96E-02 -4.47E-01 -1.05E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.51E-01 -7.27E-02 -2.51E-01
Myelofibrosis 2A20.2 Whole blood 1.05E-01 1.36E-01 9.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.65E-01 -1.66E-01 -2.12E-01
Myopathy 8C70.6 Muscle tissue 5.86E-01 -7.19E-02 -2.05E-01
Neonatal sepsis KA60 Whole blood 8.69E-04 7.89E-02 2.47E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.89E-06 6.39E-01 2.69E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.49E-01 2.89E-01 6.25E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.80E-02 3.39E-01 8.13E-01
Olive pollen allergy CA08.00 Peripheral blood 2.48E-01 -4.76E-01 -8.94E-01
Oral cancer 2B6E Oral tissue 2.54E-04 4.92E-01 9.32E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.87E-01 1.59E-01 4.67E-01
Osteoporosis FB83.1 Bone marrow 8.14E-03 -8.02E-01 -1.76E+00
Ovarian cancer 2C73 Ovarian tissue 2.85E-08 9.70E-01 4.73E+00
Pancreatic cancer 2C10 Pancreas 8.52E-02 1.37E-01 4.34E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.55E-03 -2.28E-01 -1.69E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.07E-01 1.85E-01 7.25E-01
Pituitary cancer 2D12 Pituitary tissue 6.38E-01 -5.87E-02 -1.77E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.04E-01 -2.41E-01 -8.05E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.22E-01 9.28E-02 3.65E-01
Polycythemia vera 2A20.4 Whole blood 2.02E-01 4.80E-02 3.63E-01
Pompe disease 5C51.3 Biceps muscle 1.70E-03 6.46E-01 2.30E+00
Preterm birth KA21.4Z Myometrium 2.86E-01 4.92E-01 2.20E+00
Prostate cancer 2C82 Prostate 1.55E-06 1.14E+00 1.80E+00
Psoriasis EA90 Skin 2.59E-24 7.00E-01 1.52E+00
Rectal cancer 2B92 Rectal colon tissue 6.46E-01 1.08E-01 1.56E-01
Renal cancer 2C90-2C91 Kidney 8.74E-02 2.66E-01 5.49E-01
Retinoblastoma 2D02.2 Uvea 3.82E-05 1.03E+00 3.95E+00
Rheumatoid arthritis FA20 Synovial tissue 1.78E-01 -3.50E-01 -1.31E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.78E-01 9.91E-03 5.89E-02
Schizophrenia 6A20 Prefrontal cortex 2.51E-01 8.56E-02 2.59E-01
Schizophrenia 6A20 Superior temporal cortex 9.21E-01 2.36E-02 1.80E-01
Scleroderma 4A42.Z Whole blood 2.31E-01 -1.15E-01 -4.72E-01
Seizure 8A60-8A6Z Whole blood 6.38E-01 2.78E-01 7.29E-01
Sensitive skin EK0Z Skin 2.66E-01 1.04E-01 6.44E-01
Sepsis with septic shock 1G41 Whole blood 5.97E-01 7.72E-03 2.26E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.29E-01 1.50E-01 5.62E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.16E-01 -6.72E-02 -4.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.16E-01 -1.88E-02 -9.83E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.37E-01 7.68E-02 2.90E-01
Skin cancer 2C30-2C3Z Skin 4.34E-37 1.01E+00 1.50E+00
Thrombocythemia 3B63 Whole blood 1.34E-01 -5.26E-04 -3.56E-03
Thrombocytopenia 3B64 Whole blood 8.48E-01 -3.65E-02 -5.82E-02
Thyroid cancer 2D10 Thyroid 2.39E-05 1.38E-01 3.97E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.45E-01 -1.31E-01 -6.63E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.24E-01 -3.35E-03 -2.45E-02
Type 2 diabetes 5A11 Liver tissue 3.28E-01 7.14E-02 2.72E-01
Ureter cancer 2C92 Urothelium 3.72E-01 -4.08E-03 -4.63E-02
Uterine cancer 2C78 Endometrium tissue 4.75E-32 8.71E-01 1.60E+00
Vitiligo ED63.0 Skin 1.19E-01 -6.63E-02 -3.84E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Investigative Drug(s)
Drug Name Highest Status Cell Line Affinity REF
Coenzyme A Investigative Yeast cells-GDC Km = 140.0 microM [1]

References

1 Biochemical characterization of a new mitochondrial transporter of dephosphocoenzyme A in Drosophila melanogaster. Biochim Biophys Acta Bioenerg. 2017 Feb;1858(2):137-146.