Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTOTKBS)

DTP Name Zinc transporter ZIP13 (SLC39A13)
Gene Name SLC39A13
UniProt ID
Q96H72 (S39AD_HUMAN)
VARIDT ID
DTD0341
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms EDSSPD3; LIV-1 subfamily of ZIP zinc transporter 9; LZT-Hs9; SCDEDS; SLC39A13; Solute carrier family 39 member 13; ZIP-13; ZIP13; Zinc transporter ZIP13
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Sequence
MPGCPCPGCGMAGPRLLFLTALALELLERAGGSQPALRSRGTATACRLDNKESESWGALL
SGERLDTWICSLLGSLMVGLSGVFPLLVIPLEMGTMLRSEAGAWRLKQLLSFALGGLLGN
VFLHLLPEAWAYTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQA
PNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTIDNFTHGLAVAASF
LVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTALGGLLGAGFAICT
QSPKGVVGCSPAAEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSLQQLLLLCAGI
VVMVLFSLFVD
Function This transporter scts as a zinc-influx transporter.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.4.12
Gene ID
91252
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.11E-38 3.31E-01 1.49E+00
Adrenocortical carcinoma 2D11.Z Kidney 3.38E-01 1.02E-01 5.34E-01
Alopecia ED70 Skin from scalp 1.01E-01 1.34E-01 4.27E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.96E-02 3.69E-02 1.99E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.24E-01 8.00E-02 4.73E-01
Aortic stenosis BB70 Calcified aortic valve 1.11E-01 1.69E-01 9.48E-01
Apnea 7A40 Hyperplastic tonsil 4.09E-01 -2.48E-01 -1.99E+00
Arthropathy FA00-FA5Z Peripheral blood 1.01E-01 -1.03E-01 -5.13E-01
Asthma CA23 Nasal and bronchial airway 8.01E-01 7.61E-03 2.39E-02
Atopic dermatitis EA80 Skin 2.59E-04 2.32E-01 9.36E-01
Autism 6A02 Whole blood 9.43E-03 -1.33E-01 -7.22E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.29E-01 4.82E-02 1.74E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.44E-01 -4.90E-01 -1.75E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.36E-07 2.15E-01 7.42E-01
Batten disease 5C56.1 Whole blood 8.46E-01 -4.12E-02 -2.97E-01
Behcet's disease 4A62 Peripheral blood 2.60E-01 -5.37E-02 -2.76E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.32E-01 -6.95E-03 -5.54E-02
Bladder cancer 2C94 Bladder tissue 1.11E-01 3.24E-01 8.37E-01
Breast cancer 2C60-2C6Z Breast tissue 3.43E-25 2.62E-01 8.13E-01
Cardioembolic stroke 8B11.20 Whole blood 3.33E-04 -1.41E-01 -8.97E-01
Cervical cancer 2C77 Cervical tissue 3.84E-01 1.24E-01 4.02E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.96E-01 7.06E-02 2.45E-01
Chronic hepatitis C 1E51.1 Whole blood 3.66E-01 -5.21E-02 -4.03E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.47E-02 -1.35E-01 -4.30E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.65E-01 -8.55E-03 -2.68E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.36E-01 1.60E-01 1.02E+00
Colon cancer 2B90 Colon tissue 5.68E-56 4.41E-01 1.90E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.45E-01 -2.83E-01 -8.75E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.75E-01 -2.09E-01 -8.60E-01
Endometriosis GA10 Endometrium tissue 1.41E-01 1.97E-01 4.16E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.85E-02 9.29E-02 8.37E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.76E-02 -2.36E-01 -1.09E+00
Gastric cancer 2B72 Gastric tissue 8.46E-01 2.14E-01 3.48E-01
Glioblastopma 2A00.00 Nervous tissue 8.78E-12 -1.70E-01 -4.47E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.15E-02 2.23E-02 6.31E-02
Head and neck cancer 2D42 Head and neck tissue 2.41E-16 4.80E-01 1.35E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.58E-02 1.57E-01 7.53E-01
Huntington's disease 8A01.10 Whole blood 5.67E-02 9.81E-02 5.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.46E-01 -7.77E-02 -3.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.61E-01 -8.31E-02 -6.92E-01
Influenza 1.00E+30 Whole blood 1.05E-02 -6.58E-01 -8.91E+00
Interstitial cystitis GC00.3 Bladder tissue 3.89E-01 1.29E-01 3.93E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.91E-02 2.22E-01 5.80E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.53E-01 -1.34E-01 -4.36E-01
Ischemic stroke 8B11 Peripheral blood 6.79E-01 1.21E-03 9.59E-03
Juvenile idiopathic arthritis FA24 Peripheral blood 7.16E-04 -2.17E-01 -6.26E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.15E-02 -3.33E-01 -8.39E-01
Lateral sclerosis 8B60.4 Skin 8.10E-01 -1.69E-03 -7.08E-03
Liver cancer 2C12.0 Liver tissue 4.85E-12 3.35E-01 1.38E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.26E-02 4.10E-01 1.07E+00
Lung cancer 2C25 Lung tissue 4.14E-17 -2.45E-01 -7.04E-01
Lupus erythematosus 4A40 Whole blood 6.34E-01 5.41E-02 2.12E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.47E-01 -4.43E-02 -1.65E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.93E-01 -2.32E-03 -1.94E-02
Melanoma 2C30 Skin 5.77E-01 3.79E-01 3.87E-01
Multiple myeloma 2A83.1 Bone marrow 4.94E-04 3.99E-01 2.11E+00
Multiple myeloma 2A83.1 Peripheral blood 9.99E-01 5.30E-02 2.88E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.37E-02 -1.50E-01 -9.66E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.52E-01 -3.44E-02 -1.33E-01
Myelofibrosis 2A20.2 Whole blood 6.12E-05 -7.69E-02 -8.78E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.11E-02 -1.57E-01 -4.88E-01
Myopathy 8C70.6 Muscle tissue 2.69E-02 1.91E-01 9.72E-01
Neonatal sepsis KA60 Whole blood 5.67E-04 -1.15E-01 -5.23E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.25E-05 -4.96E-01 -2.52E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.50E-01 -1.96E-01 -1.26E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.97E-01 -1.89E-02 -3.76E-01
Olive pollen allergy CA08.00 Peripheral blood 3.48E-01 1.65E-01 6.79E-01
Oral cancer 2B6E Oral tissue 2.52E-04 1.86E-01 7.85E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.74E-01 4.80E-01 4.13E-01
Osteoporosis FB83.1 Bone marrow 3.18E-02 3.12E-01 1.81E+00
Ovarian cancer 2C73 Ovarian tissue 6.97E-01 1.07E-01 3.92E-01
Pancreatic cancer 2C10 Pancreas 2.60E-03 5.18E-01 1.19E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.62E-01 5.65E-02 3.68E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.59E-01 -3.98E-02 -2.10E-01
Pituitary cancer 2D12 Pituitary tissue 6.97E-02 3.41E-02 2.59E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.51E-01 -7.08E-02 -4.48E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.29E-01 5.01E-03 4.16E-02
Polycythemia vera 2A20.4 Whole blood 1.74E-11 -1.47E-01 -1.48E+00
Pompe disease 5C51.3 Biceps muscle 5.66E-04 1.73E-01 1.58E+00
Preterm birth KA21.4Z Myometrium 1.33E-01 3.14E-01 1.67E+00
Prostate cancer 2C82 Prostate 9.14E-04 -4.34E-01 -1.00E+00
Psoriasis EA90 Skin 4.74E-03 -1.81E-01 -4.44E-01
Rectal cancer 2B92 Rectal colon tissue 4.05E-02 1.80E-01 7.39E-01
Renal cancer 2C90-2C91 Kidney 9.79E-04 -4.74E-01 -1.42E+00
Retinoblastoma 2D02.2 Uvea 6.73E-01 -5.31E-02 -2.76E-01
Rheumatoid arthritis FA20 Synovial tissue 1.22E-05 1.48E+00 4.72E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.18E-01 -2.13E-02 -1.94E-01
Schizophrenia 6A20 Prefrontal cortex 7.42E-01 -2.89E-02 -1.53E-01
Schizophrenia 6A20 Superior temporal cortex 3.21E-02 -5.41E-02 -4.44E-01
Scleroderma 4A42.Z Whole blood 1.60E-02 2.38E-01 1.20E+00
Seizure 8A60-8A6Z Whole blood 5.66E-01 6.27E-03 3.56E-02
Sensitive skin EK0Z Skin 4.17E-01 1.36E-01 1.01E+00
Sepsis with septic shock 1G41 Whole blood 1.98E-06 -8.87E-02 -4.15E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.45E-01 -8.28E-02 -5.87E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.80E-02 1.75E-01 1.65E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 8.83E-01 -2.19E-02 -6.26E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.42E-01 -2.35E-01 -1.34E+00
Skin cancer 2C30-2C3Z Skin 3.48E-01 4.68E-02 1.02E-01
Thrombocythemia 3B63 Whole blood 1.01E-04 -1.00E-01 -1.03E+00
Thrombocytopenia 3B64 Whole blood 3.67E-01 5.74E-01 5.25E-01
Thyroid cancer 2D10 Thyroid 1.15E-11 2.07E-01 7.93E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.51E-02 1.76E-01 4.17E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.31E-01 6.95E-02 4.64E-01
Type 2 diabetes 5A11 Liver tissue 4.62E-01 -7.84E-02 -2.81E-01
Ureter cancer 2C92 Urothelium 5.39E-01 -1.72E-02 -1.18E-01
Uterine cancer 2C78 Endometrium tissue 3.33E-19 -6.65E-01 -1.00E+00
Vitiligo ED63.0 Skin 2.58E-01 -1.49E-02 -7.71E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Promotion of vesicular zinc efflux by ZIP13 and its implications for spondylocheiro dysplastic Ehlers-Danlos syndrome. Proc Natl Acad Sci U S A. 2012 Dec 18;109(51):E3530-8.