Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTP8L4F)

DTP Name High affinity copper uptake protein 1 (SLC31A1)
Gene Name SLC31A1
UniProt ID
O15431 (COPT1_HUMAN)
VARIDT ID
DTD0278
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms COPT1; CTR1; Copper transporter 1; SLC31A1; Solute carrier family 31 member 1; hCTR1
DTP Family Copper Transporter (CTR) Family ;
Sequence
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG
LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH
KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA
VVVDITEHCH
Function This high-affinity transporter involved in dietary copper uptake.
Endogenous Substrate(s) Ag+; Cu+
TCDB ID
1.A.56.1.2
Gene ID
1317
KEGG Pathway
Platinum drug resistance (hsa01524 )
Mineral absorption (hsa04978 )
Reactome Pathway
Metal ion SLC transporters (R-HSA-425410 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
4 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Carboplatin DMG281S Adenocarcinoma 2D40 Approved [1]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [1]
Cupric Sulfate DMP0NFQ Fungal infection 1F29-1F2F Approved [2]
Oxaliplatin DMQNWRD Adenocarcinoma 2D40 Approved [3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.90E-35 -7.49E-01 -1.60E+00
Adrenocortical carcinoma 2D11.Z Kidney 6.28E-02 3.18E-01 6.71E-01
Alopecia ED70 Skin from scalp 5.07E-01 -7.94E-02 -2.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.74E-01 1.53E-03 5.56E-03
Ankylosing spondylitis FA92.0 Pheripheral blood 1.30E-01 -1.30E-01 -5.10E-01
Aortic stenosis BB70 Calcified aortic valve 3.81E-02 4.52E-01 8.88E-01
Apnea 7A40 Hyperplastic tonsil 3.73E-01 -1.91E-01 -1.80E+00
Arthropathy FA00-FA5Z Peripheral blood 3.81E-01 -7.22E-04 -3.22E-03
Asthma CA23 Nasal and bronchial airway 1.94E-06 5.87E-01 5.82E-01
Atopic dermatitis EA80 Skin 5.82E-04 -3.61E-01 -1.08E+00
Autism 6A02 Whole blood 3.87E-01 -8.75E-02 -2.57E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.57E-01 6.29E-01 2.26E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.07E-01 -6.35E-01 -1.16E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.78E-06 -2.02E-01 -6.00E-01
Batten disease 5C56.1 Whole blood 1.43E-01 -1.80E-01 -9.03E-01
Behcet's disease 4A62 Peripheral blood 2.49E-01 4.33E-03 1.00E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.59E-02 6.18E-02 4.01E-01
Bladder cancer 2C94 Bladder tissue 9.48E-01 -1.08E-01 -3.77E-01
Breast cancer 2C60-2C6Z Breast tissue 8.18E-58 5.14E-01 1.27E+00
Cardioembolic stroke 8B11.20 Whole blood 1.68E-04 4.33E-01 1.36E+00
Cervical cancer 2C77 Cervical tissue 8.13E-02 8.24E-02 3.73E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.15E-01 -6.36E-02 -1.58E-01
Chronic hepatitis C 1E51.1 Whole blood 7.87E-01 -5.12E-02 -1.01E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.30E-01 -4.35E-02 -1.07E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.40E-01 1.36E-02 2.65E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.39E-02 -1.18E+00 -1.05E+00
Colon cancer 2B90 Colon tissue 5.23E-01 -4.29E-02 -1.04E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.06E-01 -7.27E-03 -1.65E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.35E-01 -3.14E-02 -1.04E-01
Endometriosis GA10 Endometrium tissue 4.71E-01 -5.88E-01 -6.24E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.39E-01 -1.73E-01 -7.82E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.12E-07 1.07E+00 1.56E+00
Gastric cancer 2B72 Gastric tissue 3.71E-01 4.82E-01 4.24E-01
Glioblastopma 2A00.00 Nervous tissue 1.07E-119 9.06E-01 2.14E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.68E-01 -1.22E-01 -1.50E-01
Head and neck cancer 2D42 Head and neck tissue 4.84E-07 -4.68E-01 -6.31E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.48E-02 1.24E-01 5.18E-01
Huntington's disease 8A01.10 Whole blood 3.10E-01 -2.25E-01 -5.50E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.71E-01 9.89E-02 2.04E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.73E-04 2.80E-01 1.62E+00
Influenza 1.00E+30 Whole blood 5.06E-03 -8.22E-01 -6.11E+00
Interstitial cystitis GC00.3 Bladder tissue 2.75E-01 9.76E-02 7.00E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.26E-08 1.00E+00 2.94E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.83E-01 1.00E-01 2.55E-01
Ischemic stroke 8B11 Peripheral blood 1.65E-01 -1.31E-01 -3.54E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.52E-04 -1.70E-01 -4.30E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.77E-02 1.03E-01 4.60E-01
Lateral sclerosis 8B60.4 Skin 4.05E-01 -2.27E-01 -4.88E-01
Liver cancer 2C12.0 Liver tissue 5.18E-21 -8.32E-01 -2.27E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.08E-05 -1.27E+00 -4.27E+00
Lung cancer 2C25 Lung tissue 8.17E-14 -2.70E-01 -4.89E-01
Lupus erythematosus 4A40 Whole blood 3.36E-02 1.39E-01 1.99E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.60E-01 1.01E-01 3.73E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.73E-01 -7.53E-03 -4.42E-02
Melanoma 2C30 Skin 4.75E-01 -1.78E-01 -2.87E-01
Multiple myeloma 2A83.1 Bone marrow 1.60E-04 6.41E-01 2.36E+00
Multiple myeloma 2A83.1 Peripheral blood 4.73E-01 -8.67E-02 -9.92E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.27E-01 -5.65E-03 -7.24E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.89E-02 -1.05E-01 -6.14E-01
Myelofibrosis 2A20.2 Whole blood 4.85E-01 -2.15E-01 -7.85E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.80E-01 5.63E-01 6.76E-01
Myopathy 8C70.6 Muscle tissue 7.82E-04 5.15E-01 1.37E+00
Neonatal sepsis KA60 Whole blood 1.22E-18 6.56E-01 1.53E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.43E-06 1.50E+00 2.69E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.69E-01 3.00E-01 1.50E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.71E-01 9.76E-02 4.23E-01
Olive pollen allergy CA08.00 Peripheral blood 6.14E-01 6.07E-02 1.59E-01
Oral cancer 2B6E Oral tissue 9.10E-04 6.10E-01 6.41E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.22E-01 4.45E-01 6.44E-01
Osteoporosis FB83.1 Bone marrow 7.39E-01 -1.53E-02 -2.94E-01
Ovarian cancer 2C73 Ovarian tissue 1.15E-03 1.15E+00 2.10E+00
Pancreatic cancer 2C10 Pancreas 4.78E-05 3.39E-01 1.04E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.41E-01 1.47E-01 7.52E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.52E-03 5.96E-01 1.12E+00
Pituitary cancer 2D12 Pituitary tissue 3.78E-02 -1.81E-01 -3.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.51E-02 -3.55E-01 -1.01E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.55E-01 2.13E-02 1.10E-01
Polycythemia vera 2A20.4 Whole blood 7.12E-01 -5.49E-02 -1.93E-01
Pompe disease 5C51.3 Biceps muscle 1.71E-03 7.67E-01 1.67E+00
Preterm birth KA21.4Z Myometrium 7.21E-01 -4.60E-02 -1.37E-01
Prostate cancer 2C82 Prostate 3.34E-01 1.93E-01 1.95E-01
Psoriasis EA90 Skin 2.01E-05 2.59E-01 4.91E-01
Rectal cancer 2B92 Rectal colon tissue 8.91E-02 -2.12E-01 -5.46E-01
Renal cancer 2C90-2C91 Kidney 8.97E-03 3.32E-01 9.33E-01
Retinoblastoma 2D02.2 Uvea 1.80E-09 1.73E+00 6.22E+00
Rheumatoid arthritis FA20 Synovial tissue 2.11E-03 7.96E-01 2.27E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.62E-01 -9.50E-03 -3.29E-02
Schizophrenia 6A20 Prefrontal cortex 1.72E-01 7.15E-02 9.19E-02
Schizophrenia 6A20 Superior temporal cortex 7.26E-01 1.32E-02 9.99E-02
Scleroderma 4A42.Z Whole blood 4.57E-01 1.23E-01 4.12E-01
Seizure 8A60-8A6Z Whole blood 1.71E-01 -2.65E-01 -5.74E-01
Sensitive skin EK0Z Skin 7.27E-01 -1.82E-03 -8.76E-03
Sepsis with septic shock 1G41 Whole blood 1.22E-32 5.78E-01 1.23E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.21E-01 -2.83E-01 -9.21E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.59E-04 -5.79E-01 -2.18E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.16E-01 1.17E-01 5.62E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.03E-02 -6.56E-01 -6.07E+00
Skin cancer 2C30-2C3Z Skin 4.80E-08 -3.64E-01 -6.35E-01
Thrombocythemia 3B63 Whole blood 7.61E-01 -6.23E-02 -2.36E-01
Thrombocytopenia 3B64 Whole blood 3.76E-01 2.26E-02 4.80E-02
Thyroid cancer 2D10 Thyroid 7.21E-01 7.55E-03 2.76E-02
Tibial muscular dystrophy 8C75 Muscle tissue 7.17E-03 2.38E-01 1.20E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.94E-01 -4.49E-02 -3.11E-01
Type 2 diabetes 5A11 Liver tissue 4.58E-01 -1.38E-02 -6.46E-02
Ureter cancer 2C92 Urothelium 7.19E-01 -2.08E-02 -3.17E-02
Uterine cancer 2C78 Endometrium tissue 2.34E-03 2.14E-01 3.76E-01
Vitiligo ED63.0 Skin 9.23E-01 -1.71E-01 -4.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Overcoming platinum drug resistance with copper-lowering agents. Anticancer Res. 2013 Oct;33(10):4157-61.
2 Role of the copper transporter, CTR1, in platinum-induced ototoxicity. J Neurosci. 2010 Jul 14;30(28):9500-9.
3 Copper transporters regulate the cellular pharmacology and sensitivity to Pt drugs. Crit Rev Oncol Hematol. 2005 Jan;53(1):13-23.