Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTSQY0W)

DTP Name Anion exchange protein 4 (SLC4A9)
Gene Name SLC4A9
UniProt ID
Q96Q91 (B3A4_HUMAN)
VARIDT ID
DTD0389
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms AE 4; AE4; Anion exchanger 4; SBC5; SLC4A9; Sodium bicarbonate cotransporter 5; Solute carrier family 4 member 9
DTP Family Anion Exchanger (AE) Family ;
Tissue Specificity Kidney specific.
Sequence
MEMKLPGQEGFEASSAPRNIPSGELDSNPDPGTGPSPDGPSDTESKELGVPKDPLLFIQL
NELLGWPQALEWRETGSSSASLLLDMGEMPSITLSTHLHHRWVLFEEKLEVAAGRWSAPH
VPTLALPSLQKLRSLLAEGLVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQ
HYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNPLRQKLPPGAEAGTVLAGELGFLAQP
LGAFVRLRNPVVLGSLTEVSLPSRFFCLLLGPCMLGKGYHEMGRAAAVLLSDPQFQWSVR
RASNLHDLLAALDAFLEEVTVLPPGRWDPTARIPPPKCLPSQHKRLPSQQREIRGPAVPR
LTSAEDRHRHGPHAHSPELQRTGRLFGGLIQDVRRKVPWYPSDFLDALHLQCFSAVLYIY
LATVTNAITFGGLLGDATDGAQGVLESFLGTAVAGAAFCLMAGQPLTILSSTGPVLVFER
LLFSFSRDYSLDYLPFRLWVGIWVATFCLVLVATEASVLVRYFTRFTEEGFCALISLIFI
YDAVGKMLNLTHTYPIQKPGSSAYGCLCQYPGPGGNESQWIRTRPKDRDDIVSMDLGLIN
ASLLPPPECTRQGGHPRGPGCHTVPDIAFFSLLLFLTSFFFAMALKCVKTSRFFPSVVRK
GLSDFSSVLAILLGCGLDAFLGLATPKLMVPREFKPTLPGRGWLVSPFGANPWWWSVAAA
LPALLLSILIFMDQQITAVILNRMEYRLQKGAGFHLDLFCVAVLMLLTSALGLPWYVSAT
VISLAHMDSLRRESRACAPGERPNFLGIREQRLTGLVVFILTGASIFLAPVLKFIPMPVL
YGIFLYMGVAALSSIQFTNRVKLLLMPAKHQPDLLLLRHVPLTRVHLFTAIQLACLGLLW
IIKSTPAAIIFPLMLLGLVGVRKALERVFSPQELLWLDELMPEEERSIPEKGLEPEHSFS
GSDSEDSELMYQPKAPEINISVN
Function This transporter is a probable apical anion exchanger of the kidney cortex.
Endogenous Substrate(s) Na+
TCDB ID
2.A.31.2.13
Gene ID
83697
Reactome Pathway
Bicarbonate transporters (R-HSA-425381 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium bicarbonate DMMU6BJ Metabolic acidosis 5C73 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.73E-05 6.91E-02 5.03E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.76E-01 -5.22E-02 -3.42E-01
Alopecia ED70 Skin from scalp 9.24E-01 -9.87E-03 -5.78E-02
Alzheimer's disease 8A20 Entorhinal cortex 8.42E-03 6.75E-02 4.37E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.48E-01 -1.33E-01 -1.12E+00
Aortic stenosis BB70 Calcified aortic valve 7.47E-01 3.49E-03 6.43E-03
Apnea 7A40 Hyperplastic tonsil 8.66E-01 -1.08E-01 -4.12E-01
Arthropathy FA00-FA5Z Peripheral blood 3.25E-01 -1.97E-02 -2.10E-01
Asthma CA23 Nasal and bronchial airway 3.48E-02 -1.05E-01 -2.50E-01
Atopic dermatitis EA80 Skin 8.38E-03 6.45E-02 9.46E-01
Autism 6A02 Whole blood 9.84E-01 -3.83E-02 -2.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.68E-02 -1.91E-01 -1.69E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.31E-01 -1.19E-01 -1.21E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.17E-01 9.33E-03 6.15E-02
Batten disease 5C56.1 Whole blood 7.97E-01 1.72E-02 1.55E-01
Behcet's disease 4A62 Peripheral blood 7.87E-01 4.87E-02 2.64E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.69E-01 -3.45E-03 -3.37E-02
Bladder cancer 2C94 Bladder tissue 1.62E-03 4.78E-01 1.96E+00
Breast cancer 2C60-2C6Z Breast tissue 5.49E-04 -4.17E-02 -1.81E-01
Cardioembolic stroke 8B11.20 Whole blood 2.67E-02 9.10E-02 6.18E-01
Cervical cancer 2C77 Cervical tissue 6.99E-01 8.15E-02 3.45E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.93E-01 -3.33E-02 -1.80E-01
Chronic hepatitis C 1E51.1 Whole blood 1.82E-01 2.02E-02 1.76E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.93E-01 7.97E-03 9.28E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.01E-03 7.92E-02 4.98E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.48E-01 3.52E-02 3.33E-01
Colon cancer 2B90 Colon tissue 2.56E-05 -8.80E-02 -4.32E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.32E-01 -7.13E-02 -3.62E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.39E-01 -4.85E-02 -3.10E-01
Endometriosis GA10 Endometrium tissue 4.57E-01 -5.80E-03 -2.23E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.98E-01 6.47E-02 6.05E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.24E-02 -9.52E-02 -5.71E-01
Gastric cancer 2B72 Gastric tissue 2.91E-01 -2.02E-01 -1.19E+00
Glioblastopma 2A00.00 Nervous tissue 2.56E-60 -2.33E-01 -1.07E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.75E-04 -5.18E-01 -2.09E+00
Head and neck cancer 2D42 Head and neck tissue 4.90E-01 3.99E-02 2.55E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.31E-01 1.06E-02 5.34E-02
Huntington's disease 8A01.10 Whole blood 8.54E-01 -3.57E-02 -2.64E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.28E-01 -1.50E-01 -8.99E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.31E-01 -2.03E-03 -3.28E-02
Influenza 1.00E+30 Whole blood 1.28E-01 2.74E-01 1.90E+00
Interstitial cystitis GC00.3 Bladder tissue 2.96E-01 5.21E-02 4.82E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.97E-01 -1.07E-01 -7.29E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.00E-01 1.28E-01 3.92E-01
Ischemic stroke 8B11 Peripheral blood 5.20E-01 8.83E-02 6.30E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.18E-01 7.18E-02 3.96E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.33E-01 2.50E-03 1.65E-02
Lateral sclerosis 8B60.4 Skin 5.68E-01 -6.56E-02 -4.46E-01
Liver cancer 2C12.0 Liver tissue 4.62E-03 -8.08E-02 -3.68E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.10E-01 -9.11E-02 -6.54E-01
Lung cancer 2C25 Lung tissue 3.22E-01 4.14E-03 2.76E-02
Lupus erythematosus 4A40 Whole blood 4.56E-01 3.58E-02 1.67E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.55E-02 7.50E-02 3.86E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.80E-01 1.80E-04 1.60E-03
Melanoma 2C30 Skin 1.31E-02 -2.09E-01 -6.06E-01
Multiple myeloma 2A83.1 Bone marrow 7.99E-04 -3.96E-01 -1.99E+00
Multiple myeloma 2A83.1 Peripheral blood 4.07E-01 -1.46E-02 -9.22E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.83E-01 -2.26E-01 -9.22E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.74E-01 -1.23E-02 -1.15E-01
Myelofibrosis 2A20.2 Whole blood 3.87E-01 7.06E-03 5.73E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.85E-01 -1.14E-02 -3.29E-02
Myopathy 8C70.6 Muscle tissue 9.44E-02 -6.51E-02 -6.65E-01
Neonatal sepsis KA60 Whole blood 2.79E-01 -4.75E-02 -2.76E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.67E-02 -4.13E-01 -1.22E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.48E-01 -4.15E-02 -3.59E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.23E-01 -1.94E-02 -3.60E-01
Olive pollen allergy CA08.00 Peripheral blood 7.41E-01 -5.45E-03 -2.06E-02
Oral cancer 2B6E Oral tissue 3.75E-08 -3.23E-01 -1.38E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.93E-01 -5.59E-02 -1.56E-01
Osteoporosis FB83.1 Bone marrow 4.10E-01 7.03E-02 5.29E-01
Ovarian cancer 2C73 Ovarian tissue 2.54E-01 -2.66E-02 -1.13E-01
Pancreatic cancer 2C10 Pancreas 4.62E-03 -2.34E-01 -1.07E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.13E-01 2.22E-03 1.51E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.41E-03 -8.73E-02 -8.08E-01
Pituitary cancer 2D12 Pituitary tissue 1.10E-03 1.85E-01 1.29E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.63E-02 1.72E-01 1.19E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.63E-01 1.58E-02 7.43E-02
Polycythemia vera 2A20.4 Whole blood 7.41E-01 -7.56E-03 -5.92E-02
Pompe disease 5C51.3 Biceps muscle 5.03E-01 -9.51E-02 -1.46E+00
Preterm birth KA21.4Z Myometrium 2.75E-01 6.02E-02 8.92E-01
Prostate cancer 2C82 Prostate 4.13E-01 -4.51E-02 -2.03E-01
Psoriasis EA90 Skin 1.49E-01 1.30E-02 5.99E-02
Rectal cancer 2B92 Rectal colon tissue 6.00E-02 -2.04E-01 -1.23E+00
Renal cancer 2C90-2C91 Kidney 1.95E-04 -1.80E+00 -2.02E+00
Retinoblastoma 2D02.2 Uvea 8.68E-02 -9.68E-02 -7.29E-01
Rheumatoid arthritis FA20 Synovial tissue 7.26E-02 -2.26E-01 -6.44E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.81E-01 2.06E-02 1.84E-01
Schizophrenia 6A20 Prefrontal cortex 4.95E-01 3.82E-02 1.99E-01
Schizophrenia 6A20 Superior temporal cortex 1.18E-01 -4.48E-02 -3.31E-01
Scleroderma 4A42.Z Whole blood 6.48E-01 7.00E-02 4.70E-01
Seizure 8A60-8A6Z Whole blood 5.92E-01 -7.14E-02 -5.00E-01
Sensitive skin EK0Z Skin 8.05E-01 1.81E-03 1.52E-02
Sepsis with septic shock 1G41 Whole blood 6.30E-01 1.22E-03 6.17E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.28E-01 -6.34E-03 -2.65E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.34E-01 -3.24E-02 -1.75E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.55E-01 -3.82E-02 -9.39E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.63E-02 -2.98E-01 -1.30E+00
Skin cancer 2C30-2C3Z Skin 7.28E-04 6.87E-02 3.31E-01
Thrombocythemia 3B63 Whole blood 4.05E-01 5.58E-03 4.51E-02
Thrombocytopenia 3B64 Whole blood 3.12E-01 7.67E-02 6.87E-01
Thyroid cancer 2D10 Thyroid 4.67E-05 4.92E-02 3.36E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.96E-05 -2.86E-01 -1.41E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.32E-01 3.54E-02 6.06E-01
Type 2 diabetes 5A11 Liver tissue 1.63E-01 6.21E-02 7.72E-01
Ureter cancer 2C92 Urothelium 9.31E-01 4.17E-03 3.56E-02
Uterine cancer 2C78 Endometrium tissue 1.61E-02 -6.83E-02 -3.08E-01
Vitiligo ED63.0 Skin 1.05E-02 -9.81E-02 -1.39E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 A novel sodium bicarbonate cotransporter-like gene in an ancient duplicated region: SLC4A9 at 5q31. Genome Biol. 2001;2(4):RESEARCH0011.