Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTU4HKJ)

DTP Name Mitochondrial coenzyme A transporter SLC25A42 (SLC25A42)
Gene Name SLC25A42
UniProt ID
Q86VD7 (S2542_HUMAN)
VARIDT ID
DTD0205
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC25A42; Solute carrier family 25 member 42
DTP Family Mitochondrial Carrier (MC) Family ;
Sequence
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII
FQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGS
YYGFRGEALPPWPRLFAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE
EGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIG
QSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVG
ISFTTFDLMQILLRHLQS
Function This mitochondrial transporter mediates the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.
Endogenous Substrate(s) Dephospho-CoA; ADP; Adenosine 3',5'-diphosphate
TCDB ID
2.A.29.12.2
Gene ID
284439

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Coenzyme A DM1I8LU Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.90E-01 1.39E-02 7.37E-02
Adrenocortical carcinoma 2D11.Z Kidney 8.45E-01 3.14E-02 1.48E-01
Alopecia ED70 Skin from scalp 8.06E-01 -4.06E-02 -1.68E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.48E-05 -8.87E-02 -4.65E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.74E-01 -1.04E-01 -7.87E-01
Aortic stenosis BB70 Calcified aortic valve 3.46E-01 1.23E-01 4.73E-01
Apnea 7A40 Hyperplastic tonsil 3.83E-02 -1.53E-01 -1.06E+00
Arthropathy FA00-FA5Z Peripheral blood 5.64E-01 2.22E-02 1.95E-01
Asthma CA23 Nasal and bronchial airway 2.66E-02 1.36E-01 3.75E-01
Atopic dermatitis EA80 Skin 8.49E-04 -1.21E-01 -9.20E-01
Autism 6A02 Whole blood 7.63E-01 1.64E-03 9.60E-03
Autoimmune uveitis 9A96 Peripheral monocyte 5.56E-05 -2.70E-01 -2.14E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.26E-01 -9.07E-03 -6.45E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.51E-03 1.17E-01 4.93E-01
Batten disease 5C56.1 Whole blood 2.22E-01 -8.00E-02 -6.95E-01
Behcet's disease 4A62 Peripheral blood 1.89E-01 -2.03E-01 -1.23E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.31E-01 -9.23E-03 -8.90E-02
Bladder cancer 2C94 Bladder tissue 7.28E-01 7.80E-02 3.29E-01
Breast cancer 2C60-2C6Z Breast tissue 1.51E-05 5.62E-02 3.37E-01
Cardioembolic stroke 8B11.20 Whole blood 1.26E-11 -5.79E-01 -2.68E+00
Cervical cancer 2C77 Cervical tissue 4.57E-01 -4.30E-02 -2.19E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.53E-01 -2.40E-02 -1.42E-01
Chronic hepatitis C 1E51.1 Whole blood 8.29E-01 6.76E-02 3.55E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.68E-01 1.61E-02 8.87E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.03E-01 6.91E-02 4.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.29E-01 3.01E-02 4.57E-01
Colon cancer 2B90 Colon tissue 6.96E-14 -1.61E-01 -7.57E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.59E-01 -4.12E-02 -4.39E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.38E-01 -7.88E-02 -5.92E-01
Endometriosis GA10 Endometrium tissue 4.48E-01 -1.43E-01 -6.18E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.57E-01 -1.36E-01 -9.97E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.36E-02 -1.22E-01 -8.00E-01
Gastric cancer 2B72 Gastric tissue 3.03E-01 2.17E-01 1.20E+00
Glioblastopma 2A00.00 Nervous tissue 7.96E-12 -9.69E-02 -4.37E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.74E-03 -2.01E-01 -1.08E+00
Head and neck cancer 2D42 Head and neck tissue 2.49E-01 -3.08E-02 -2.29E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.77E-02 -8.09E-02 -5.78E-01
Huntington's disease 8A01.10 Whole blood 6.54E-02 1.40E-02 1.13E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.50E-01 -1.07E-01 -7.87E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.75E-01 -1.46E-01 -9.57E-01
Influenza 1.00E+30 Whole blood 2.58E-01 9.09E-02 5.24E-01
Interstitial cystitis GC00.3 Bladder tissue 8.29E-01 4.48E-02 3.13E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.85E-01 1.39E-02 9.06E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.22E-01 -5.89E-02 -2.67E-01
Ischemic stroke 8B11 Peripheral blood 4.83E-01 -3.66E-03 -1.89E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.67E-04 -1.72E-01 -6.30E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.40E-01 8.68E-02 4.83E-01
Lateral sclerosis 8B60.4 Skin 7.21E-01 -9.29E-02 -5.09E-01
Liver cancer 2C12.0 Liver tissue 1.11E-03 -2.94E-01 -9.02E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.65E-01 -1.59E-01 -5.67E-01
Lung cancer 2C25 Lung tissue 9.95E-01 -4.67E-02 -2.73E-01
Lupus erythematosus 4A40 Whole blood 1.14E-05 -1.12E-01 -2.91E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.40E-01 -7.39E-02 -3.40E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.44E-01 -1.68E-02 -1.57E-01
Melanoma 2C30 Skin 9.81E-03 -2.57E-01 -7.23E-01
Multiple myeloma 2A83.1 Bone marrow 3.53E-03 2.57E-01 1.55E+00
Multiple myeloma 2A83.1 Peripheral blood 6.92E-01 -2.83E-02 -2.52E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.33E-01 3.43E-04 1.52E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.28E-01 -6.32E-02 -3.66E-01
Myelofibrosis 2A20.2 Whole blood 4.87E-02 -1.23E-01 -9.24E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.55E-02 -1.92E-01 -3.40E-01
Myopathy 8C70.6 Muscle tissue 6.65E-01 -2.09E-02 -8.10E-02
Neonatal sepsis KA60 Whole blood 2.41E-04 -1.16E-01 -5.93E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.39E-01 -4.60E-02 -2.27E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.29E-01 3.67E-02 5.81E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.27E-01 -5.08E-02 -7.22E-01
Olive pollen allergy CA08.00 Peripheral blood 2.61E-01 1.10E-01 7.17E-01
Oral cancer 2B6E Oral tissue 1.16E-01 -9.15E-02 -4.12E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.05E-01 -6.68E-03 -3.23E-02
Osteoporosis FB83.1 Bone marrow 9.27E-02 3.85E-01 6.72E+00
Ovarian cancer 2C73 Ovarian tissue 4.79E-01 -8.93E-02 -2.94E-01
Pancreatic cancer 2C10 Pancreas 1.36E-01 -1.40E-01 -4.85E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.82E-01 -1.78E-01 -1.35E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.39E-03 -8.78E-02 -6.42E-01
Pituitary cancer 2D12 Pituitary tissue 5.26E-01 5.89E-02 3.34E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.29E-01 -4.88E-03 -2.96E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.53E-02 1.19E-01 1.02E+00
Polycythemia vera 2A20.4 Whole blood 2.16E-01 -1.32E-02 -9.08E-02
Pompe disease 5C51.3 Biceps muscle 8.47E-01 -6.55E-03 -3.12E-02
Preterm birth KA21.4Z Myometrium 6.49E-01 3.98E-03 2.37E-02
Prostate cancer 2C82 Prostate 5.49E-08 8.76E-01 1.85E+00
Psoriasis EA90 Skin 8.14E-04 -1.62E-01 -5.95E-01
Rectal cancer 2B92 Rectal colon tissue 2.52E-03 -4.41E-01 -2.18E+00
Renal cancer 2C90-2C91 Kidney 7.54E-01 -1.58E-01 -6.25E-01
Retinoblastoma 2D02.2 Uvea 1.90E-05 -2.42E-01 -2.62E+00
Rheumatoid arthritis FA20 Synovial tissue 1.42E-01 -1.56E-01 -6.01E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.02E-01 1.31E-02 1.18E-01
Schizophrenia 6A20 Prefrontal cortex 1.45E-01 5.42E-02 2.21E-01
Schizophrenia 6A20 Superior temporal cortex 1.33E-01 -4.06E-02 -4.43E-01
Scleroderma 4A42.Z Whole blood 6.47E-04 -2.87E-01 -1.85E+00
Seizure 8A60-8A6Z Whole blood 8.50E-02 8.40E-02 6.02E-01
Sensitive skin EK0Z Skin 3.04E-01 -1.31E-01 -9.65E-01
Sepsis with septic shock 1G41 Whole blood 6.18E-03 -8.76E-02 -3.74E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.07E-01 -1.21E-01 -8.09E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.75E-01 -4.82E-02 -3.88E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.46E-01 8.71E-02 8.78E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.06E-03 -2.94E-01 -3.88E+00
Skin cancer 2C30-2C3Z Skin 1.94E-19 -2.62E-01 -8.45E-01
Thrombocythemia 3B63 Whole blood 3.21E-01 -6.95E-02 -5.31E-01
Thrombocytopenia 3B64 Whole blood 3.91E-01 3.22E-01 4.60E-01
Thyroid cancer 2D10 Thyroid 6.61E-33 -8.65E-01 -1.84E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.44E-02 -2.10E-01 -8.06E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.81E-01 -6.73E-02 -4.93E-01
Type 2 diabetes 5A11 Liver tissue 6.51E-01 -9.59E-02 -7.49E-01
Ureter cancer 2C92 Urothelium 5.82E-01 7.10E-03 4.26E-02
Uterine cancer 2C78 Endometrium tissue 6.03E-02 7.48E-02 3.54E-01
Vitiligo ED63.0 Skin 9.21E-01 -6.08E-02 -3.14E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Investigative Drug(s)
Drug Name Highest Status Cell Line Affinity REF
Coenzyme A Investigative Liposomes reconstituted with SLC25A42 Km = 71.0 microM [1]

References

1 A novel member of solute carrier family 25 (SLC25A42) is a transporter of coenzyme A and adenosine 3',5'-diphosphate in human mitochondria. J Biol Chem. 2009 Jul 3;284(27):18152-9.