Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTU6IF7)

DTP Name Ammonium transporter Rh type B (SLC42A2)
Gene Name SLC42A2
UniProt ID
Q9H310 (RHBG_HUMAN)
VARIDT ID
DTD0358
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms RHBG; Rh family type B glycoprotein; Rh type B glycoprotein; Rhesus blood group family type B glycoprotein; SLC42A2
DTP Family Ammonium Transporter Channel (AMT) Family ;
Sequence
MAGSPSRAAGRRLQLPLLCLFLQGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFR
YPSFQDVHAMVFVGFGFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIH
VGVESMINADFCAGAVLISFGAVLGKTGPTQLLLMALLEVVLFGINEFVLLHLLGVRDAG
GSMTIHTFGAYFGLVLSRVLYRPQLEKSKHRQGSVYHSDLFAMIGTIFLWIFWPSFNAAL
TALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDMVHIQNAALAGGVVVGTSSEM
MLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGVLGALLGVLVA
GLATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFL
DSPPDSQHYEDQVHWQVPGEHEDKAQRPLRVEEADTQA
Function This transporter mediates the transport of ammonium.
Endogenous Substrate(s) NH4+
TCDB ID
1.A.11.4.2
Gene ID
57127
Reactome Pathway
Rhesus glycoproteins mediate ammonium transport (R-HSA-444411 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ammonia DMOEVK6 Coronary artery disease BA80 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.29E-02 6.15E-02 2.49E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.50E-01 6.26E-02 2.17E-01
Alopecia ED70 Skin from scalp 8.41E-04 -2.88E-01 -7.26E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.64E-01 1.50E-02 8.58E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.68E-02 1.04E-01 8.41E-01
Aortic stenosis BB70 Calcified aortic valve 5.42E-01 7.43E-02 7.45E-02
Apnea 7A40 Hyperplastic tonsil 3.54E-02 -3.10E-01 -1.15E+00
Arthropathy FA00-FA5Z Peripheral blood 5.40E-01 -1.56E-03 -8.36E-03
Asthma CA23 Nasal and bronchial airway 3.87E-01 -7.79E-02 -2.11E-01
Atopic dermatitis EA80 Skin 4.86E-01 3.97E-02 2.26E-01
Autism 6A02 Whole blood 3.67E-01 -8.45E-02 -2.65E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.25E-01 -4.42E-02 -4.53E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.16E-01 -5.94E-02 -3.17E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.80E-02 -4.38E-03 -1.27E-02
Batten disease 5C56.1 Whole blood 9.52E-01 -1.50E-02 -1.44E-01
Behcet's disease 4A62 Peripheral blood 3.71E-02 1.08E-01 6.55E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.39E-01 3.71E-02 1.75E-01
Bladder cancer 2C94 Bladder tissue 1.00E-06 5.93E-01 2.86E+00
Breast cancer 2C60-2C6Z Breast tissue 1.33E-42 2.94E-01 1.10E+00
Cardioembolic stroke 8B11.20 Whole blood 1.69E-04 1.61E-01 9.20E-01
Cervical cancer 2C77 Cervical tissue 5.79E-05 -3.19E-01 -9.91E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.62E-01 3.42E-02 1.33E-01
Chronic hepatitis C 1E51.1 Whole blood 2.70E-01 6.56E-02 3.38E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.26E-02 1.01E-01 3.75E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.10E-04 1.63E-01 5.86E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.69E-01 2.62E-02 2.32E-01
Colon cancer 2B90 Colon tissue 4.26E-04 -8.51E-02 -3.07E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.13E-01 -7.89E-02 -2.37E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.24E-01 -2.29E-01 -6.87E-01
Endometriosis GA10 Endometrium tissue 1.18E-01 6.31E-02 2.30E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.42E-01 -1.19E-04 -6.66E-04
Familial hypercholesterolemia 5C80.00 Whole blood 1.10E-02 -1.32E-01 -5.03E-01
Gastric cancer 2B72 Gastric tissue 5.26E-01 -2.00E-01 -7.96E-01
Glioblastopma 2A00.00 Nervous tissue 1.53E-09 -9.99E-02 -3.13E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.08E-03 -4.99E-01 -1.49E+00
Head and neck cancer 2D42 Head and neck tissue 6.39E-06 -1.86E-01 -6.39E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.17E-02 -1.03E-01 -5.39E-01
Huntington's disease 8A01.10 Whole blood 2.84E-01 -1.19E-01 -4.44E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.86E-01 1.46E-01 7.48E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.82E-01 2.11E-02 1.55E-01
Influenza 1.00E+30 Whole blood 2.44E-02 4.61E-01 1.53E+00
Interstitial cystitis GC00.3 Bladder tissue 5.51E-01 7.48E-02 3.70E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.63E-01 -1.03E-01 -4.72E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.88E-01 -8.12E-03 -4.45E-02
Ischemic stroke 8B11 Peripheral blood 3.31E-01 2.43E-02 1.53E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.85E-02 7.11E-02 2.71E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.04E-01 8.65E-02 2.24E-01
Lateral sclerosis 8B60.4 Skin 5.51E-01 2.63E-02 4.45E-01
Liver cancer 2C12.0 Liver tissue 5.13E-08 2.43E-01 3.78E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.18E-01 1.56E-01 8.62E-01
Lung cancer 2C25 Lung tissue 1.33E-11 1.36E-01 5.46E-01
Lupus erythematosus 4A40 Whole blood 4.69E-03 -3.63E-01 -5.09E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.77E-01 4.36E-02 1.95E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.16E-01 1.15E-02 5.80E-02
Melanoma 2C30 Skin 1.55E-04 -5.01E-01 -8.55E-01
Multiple myeloma 2A83.1 Bone marrow 2.10E-01 1.20E-01 4.29E-01
Multiple myeloma 2A83.1 Peripheral blood 9.29E-01 6.94E-02 6.08E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.82E-01 2.59E-02 1.11E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.86E-01 6.31E-02 3.74E-01
Myelofibrosis 2A20.2 Whole blood 3.51E-01 1.42E-02 8.23E-02
Myocardial infarction BA41-BA50 Peripheral blood 4.05E-02 5.28E-01 9.00E-01
Myopathy 8C70.6 Muscle tissue 1.99E-02 -2.91E-01 -1.26E+00
Neonatal sepsis KA60 Whole blood 2.03E-06 -2.11E-01 -7.27E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.52E-02 -2.98E-01 -7.75E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.49E-01 -8.90E-02 -4.77E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.74E-01 -1.05E-01 -8.23E-01
Olive pollen allergy CA08.00 Peripheral blood 3.45E-01 9.46E-02 4.00E-01
Oral cancer 2B6E Oral tissue 7.38E-07 -4.12E-01 -1.30E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.08E-01 -1.87E-01 -5.48E-01
Osteoporosis FB83.1 Bone marrow 5.10E-03 5.78E-01 3.09E+00
Ovarian cancer 2C73 Ovarian tissue 4.47E-04 -9.97E-01 -1.83E+00
Pancreatic cancer 2C10 Pancreas 6.07E-03 -4.62E-01 -1.10E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.44E-01 3.69E-02 1.63E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.58E-03 -1.05E-01 -6.79E-01
Pituitary cancer 2D12 Pituitary tissue 2.11E-01 2.30E-01 6.43E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.28E-02 2.20E-01 8.80E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.46E-01 -9.40E-02 -7.34E-01
Polycythemia vera 2A20.4 Whole blood 1.02E-01 5.23E-02 2.45E-01
Pompe disease 5C51.3 Biceps muscle 9.70E-02 -7.08E-02 -4.38E-01
Preterm birth KA21.4Z Myometrium 3.14E-02 -2.56E-01 -2.09E+00
Prostate cancer 2C82 Prostate 5.71E-02 -3.85E-01 -6.15E-01
Psoriasis EA90 Skin 1.24E-18 4.73E-01 1.39E+00
Rectal cancer 2B92 Rectal colon tissue 1.36E-01 -1.53E-01 -5.16E-01
Renal cancer 2C90-2C91 Kidney 1.34E-03 -1.11E+00 -1.43E+00
Retinoblastoma 2D02.2 Uvea 7.57E-01 -1.89E-03 -1.21E-02
Rheumatoid arthritis FA20 Synovial tissue 3.41E-03 -4.43E-01 -1.59E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.22E-01 -2.44E-02 -1.84E-01
Schizophrenia 6A20 Prefrontal cortex 8.06E-01 -4.35E-02 -1.61E-01
Schizophrenia 6A20 Superior temporal cortex 3.51E-02 -1.32E-01 -9.80E-01
Scleroderma 4A42.Z Whole blood 1.21E-05 5.51E-01 2.69E+00
Seizure 8A60-8A6Z Whole blood 5.31E-01 -1.41E-01 -5.94E-01
Sensitive skin EK0Z Skin 5.33E-01 -1.00E-01 -4.61E-01
Sepsis with septic shock 1G41 Whole blood 2.35E-02 -4.19E-02 -1.37E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.44E-01 6.34E-02 2.42E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.53E-01 -4.47E-02 -1.18E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.44E-01 -3.80E-02 -8.19E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.32E-01 -3.95E-01 -1.37E+00
Skin cancer 2C30-2C3Z Skin 7.32E-33 -4.75E-01 -1.17E+00
Thrombocythemia 3B63 Whole blood 1.68E-01 6.15E-02 3.11E-01
Thrombocytopenia 3B64 Whole blood 4.23E-01 2.88E-01 7.80E-01
Thyroid cancer 2D10 Thyroid 9.50E-02 9.94E-02 3.02E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.14E-02 -9.53E-02 -3.88E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.68E-03 2.40E-01 2.59E+00
Type 2 diabetes 5A11 Liver tissue 1.58E-01 -2.66E-01 -4.09E-01
Ureter cancer 2C92 Urothelium 6.24E-01 8.13E-03 2.57E-02
Uterine cancer 2C78 Endometrium tissue 3.08E-04 -1.46E-01 -3.93E-01
Vitiligo ED63.0 Skin 1.69E-01 2.71E-01 6.60E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Functional analysis of human RhCG: comparison with E. coli ammonium transporter reveals similarities in the pore and differences in the vestibule. Am J Physiol Cell Physiol. 2009 Sep;297(3):C537-47.