General Information of Drug Transporter (DTP) (ID: DTWI9TE)

DTP Name High affinity choline transporter 1 (SLC5A7)
Gene Name SLC5A7
UniProt ID
Q9GZV3 (SC5A7_HUMAN)
VARIDT ID
DTD0427
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms CHT; CHT1; CMS20; HMN7A; Hemicholinium-3-sensitive choline transporter; SLC5A7; Solute carrier family 5 member 7
DTP Family Solute:Sodium Symporter (SSS) Family ;
Tissue Specificity Expressed in putamen, spinal cord and medulla.Specific for cholinergic neurons.
Sequence
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Function
This sodium ion- and chloride ion-dependent transporter imports choline from the extracellular space into the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis.
Endogenous Substrate(s) Choline
TCDB ID
2.A.21.8.2
Gene ID
60482
KEGG Pathway
Cholinergic synapse (hsa04725 )
Choline metabolism in cancer (hsa05231 )
Reactome Pathway
Transport of bile salts and organic acids, metal ions and amine compounds (R-HSA-425366 )
Defective SLC5A7 causes distal hereditary motor neuronopathy 7A (HMN7A) (R-HSA-5619114 )
Defective SLC5A7 causes distal hereditary motor neuronopathy 7A (HMN7A) (R-HSA-5658471 )
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
triethylcholine DMUPK6G Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.62E-05 -6.70E-02 -4.86E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.90E-03 -4.45E-01 -6.86E-01
Alopecia ED70 Skin from scalp 1.26E-01 2.91E-02 1.97E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.11E-01 -4.31E-02 -2.10E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.17E-01 5.16E-02 2.88E-01
Aortic stenosis BB70 Calcified aortic valve 5.85E-01 -1.49E-01 -3.66E-01
Apnea 7A40 Hyperplastic tonsil 6.90E-01 -5.95E-02 -2.19E-01
Arthropathy FA00-FA5Z Peripheral blood 7.84E-01 3.79E-03 4.01E-02
Asthma CA23 Nasal and bronchial airway 7.21E-03 -1.83E-01 -2.44E-01
Atopic dermatitis EA80 Skin 7.68E-04 1.31E-01 9.26E-01
Autism 6A02 Whole blood 7.25E-01 -3.15E-03 -1.90E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.02E-01 -1.78E-01 -1.66E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.42E-01 -6.02E-03 -4.84E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.41E-01 -5.10E-02 -2.00E-01
Batten disease 5C56.1 Whole blood 6.12E-01 8.08E-03 7.85E-02
Behcet's disease 4A62 Peripheral blood 5.02E-01 4.38E-02 3.82E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.17E-01 -5.01E-02 -4.01E-01
Bladder cancer 2C94 Bladder tissue 5.87E-03 -8.14E-01 -1.79E+00
Breast cancer 2C60-2C6Z Breast tissue 4.42E-11 -1.37E-01 -3.97E-01
Cardioembolic stroke 8B11.20 Whole blood 9.37E-02 5.00E-02 3.34E-01
Cervical cancer 2C77 Cervical tissue 4.64E-02 -1.12E-01 -4.61E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.40E-01 3.65E-02 2.49E-01
Chronic hepatitis C 1E51.1 Whole blood 4.29E-01 4.58E-03 2.03E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 1.18E-01 1.55E-01 8.20E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.59E-06 -1.29E-01 -4.72E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.28E-01 1.13E-01 7.17E-01
Colon cancer 2B90 Colon tissue 1.57E-02 -4.62E-02 -1.95E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.44E-01 -1.20E-01 -4.68E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.82E-01 -5.52E-02 -2.58E-01
Endometriosis GA10 Endometrium tissue 5.14E-01 -3.82E-02 -1.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.28E-01 -6.88E-02 -4.50E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.71E-02 -1.44E-01 -7.29E-01
Gastric cancer 2B72 Gastric tissue 3.53E-01 -7.47E-01 -7.69E-01
Glioblastopma 2A00.00 Nervous tissue 3.24E-04 -7.82E-02 -2.07E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.75E-03 -2.32E-01 -1.51E+00
Head and neck cancer 2D42 Head and neck tissue 5.87E-13 -2.34E-01 -6.84E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.74E-01 1.28E-01 2.40E-01
Huntington's disease 8A01.10 Whole blood 2.49E-01 8.15E-02 6.91E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.88E-01 6.65E-02 2.39E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.52E-01 -5.04E-02 -6.36E-01
Influenza 1.00E+30 Whole blood 1.15E-01 1.37E-01 1.79E+00
Interstitial cystitis GC00.3 Bladder tissue 2.48E-05 -1.91E+00 -4.42E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.48E-03 -2.74E-01 -1.42E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.08E-01 -1.24E-01 -3.92E-01
Ischemic stroke 8B11 Peripheral blood 9.67E-01 -8.73E-03 -6.06E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.85E-01 5.11E-02 1.62E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.99E-01 1.02E-02 7.56E-03
Lateral sclerosis 8B60.4 Skin 1.41E-01 1.05E-01 8.95E-01
Liver cancer 2C12.0 Liver tissue 5.48E-07 -1.52E-01 -8.43E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.34E-01 -1.42E-01 -8.66E-01
Lung cancer 2C25 Lung tissue 7.90E-01 -4.83E-02 -2.20E-01
Lupus erythematosus 4A40 Whole blood 3.38E-01 -4.68E-02 -1.21E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.56E-01 1.89E-02 1.23E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.11E-01 8.48E-03 6.50E-02
Melanoma 2C30 Skin 7.96E-01 -2.35E-01 -3.63E-01
Multiple myeloma 2A83.1 Bone marrow 3.23E-04 -4.77E-01 -2.73E+00
Multiple myeloma 2A83.1 Peripheral blood 2.64E-01 1.85E-01 1.20E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.90E-01 1.17E-01 6.87E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.33E-02 -5.86E-02 -3.40E-01
Myelofibrosis 2A20.2 Whole blood 4.58E-02 -1.40E-01 -1.25E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.77E-01 2.10E-01 4.32E-01
Myopathy 8C70.6 Muscle tissue 3.11E-01 -5.36E-02 -3.57E-01
Neonatal sepsis KA60 Whole blood 1.72E-02 5.75E-02 3.36E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.93E-04 -1.41E+00 -1.81E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.24E-01 2.68E-02 3.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.37E-02 6.83E-02 2.02E+00
Olive pollen allergy CA08.00 Peripheral blood 3.88E-01 5.78E-02 3.28E-01
Oral cancer 2B6E Oral tissue 1.16E-02 -3.42E-01 -1.10E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.26E-01 -4.02E-02 -1.51E-01
Osteoporosis FB83.1 Bone marrow 2.61E-02 2.40E-01 2.73E+00
Ovarian cancer 2C73 Ovarian tissue 5.69E-01 -1.68E-01 -6.38E-01
Pancreatic cancer 2C10 Pancreas 1.17E-01 -1.52E-01 -5.13E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.53E-01 4.02E-02 2.61E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.43E-01 -3.59E-02 -3.65E-01
Pituitary cancer 2D12 Pituitary tissue 3.19E-01 9.10E-02 3.30E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.84E-01 9.45E-02 6.58E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.45E-01 -3.13E-02 -2.17E-01
Polycythemia vera 2A20.4 Whole blood 8.94E-01 1.08E-02 9.61E-02
Pompe disease 5C51.3 Biceps muscle 8.60E-01 5.07E-02 5.08E-01
Preterm birth KA21.4Z Myometrium 3.64E-02 -1.94E-01 -1.39E+00
Prostate cancer 2C82 Prostate 9.51E-05 -1.01E+00 -1.49E+00
Psoriasis EA90 Skin 4.91E-09 -1.73E-01 -6.81E-01
Rectal cancer 2B92 Rectal colon tissue 3.47E-02 6.86E-02 8.01E-01
Renal cancer 2C90-2C91 Kidney 1.07E-04 -3.76E-01 -1.98E+00
Retinoblastoma 2D02.2 Uvea 1.55E-05 -4.81E-01 -1.84E+00
Rheumatoid arthritis FA20 Synovial tissue 2.73E-01 -1.09E-01 -2.72E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.18E-01 1.96E-02 1.95E-01
Schizophrenia 6A20 Prefrontal cortex 9.92E-01 -4.61E-02 -1.37E-01
Schizophrenia 6A20 Superior temporal cortex 9.09E-01 8.46E-03 7.81E-02
Scleroderma 4A42.Z Whole blood 6.37E-01 -1.98E-02 -2.24E-01
Seizure 8A60-8A6Z Whole blood 4.45E-01 -4.66E-02 -3.01E-01
Sensitive skin EK0Z Skin 9.26E-01 -1.92E-03 -1.85E-02
Sepsis with septic shock 1G41 Whole blood 3.10E-15 1.69E-01 8.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.90E-01 4.32E-01 1.01E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.01E-01 2.73E-03 2.71E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 2.54E-01 -8.75E-02 -1.20E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.51E-01 7.70E-02 3.08E-01
Skin cancer 2C30-2C3Z Skin 2.38E-02 4.04E-02 1.18E-01
Thrombocythemia 3B63 Whole blood 5.84E-01 1.18E-02 9.78E-02
Thrombocytopenia 3B64 Whole blood 4.63E-01 5.06E-02 3.90E-01
Thyroid cancer 2D10 Thyroid 1.10E-10 -2.64E-01 -5.20E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.53E-01 5.96E-03 3.11E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.32E-02 1.31E-01 1.14E+00
Type 2 diabetes 5A11 Liver tissue 8.61E-01 -3.49E-02 -1.58E-01
Ureter cancer 2C92 Urothelium 9.61E-01 9.45E-02 4.30E-01
Uterine cancer 2C78 Endometrium tissue 1.77E-03 -1.37E-01 -3.76E-01
Vitiligo ED63.0 Skin 2.78E-01 -1.01E-01 -3.70E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name High affinity choline transporter 1 (CHT) DTT Info
DTP DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
[3H]hemicholinium-3 DM190QW N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 914).
2 The IUPHAR/BPS Guide to PHARMACOLOGY in 2018: updates and expansion to encompass the new guide to IMMUNOPHARMACOLOGY. Nucleic Acids Res. 2018 Jan 4;46(D1):D1091-D1106. (familyId=172)