Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTRV7W3)

• DTT Name: High affinity choline transporter 1 (CHT)
• Synonyms: Solute carrier family 5 member 7; Hemicholinium-3-sensitive choline transporter; CHT1; CHT
• Gene Name: SLC5A7
• DTT Type: Literature-reported target; [1]
• UniProt ID: SC5A7_HUMAN
• TTD ID: T83143
• Sequence:
  MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
  TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
  IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
  LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
  LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
  NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
  RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
  LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
  TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
  ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
• Function: Transmembrane transporter that imports choline from the extracellular space into the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion- and chloride ion-dependent.
• KEGG Pathway:
  Cholinergic synapse (hsa04725)
  Choline metabolism in cancer (hsa05231)
• Reactome Pathway:
  Transport of bile salts and organic acids, metal ions and amine compounds (R-HSA-425366)
  Defective SLC5A7 causes distal hereditary motor neuronopathy 7A (HMN7A) (R-HSA-5619114)
  Defective SLC5A7 causes distal hereditary motor neuronopathy 7A (HMN7A) (R-HSA-5658471)
  Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
[3H]hemicholinium-3	DM190QW	N. A.	N. A.	Investigative	[1]

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: High affinity choline transporter 1 (SLC5A7) DTP Info
• Gene Name: SLC5A7

1 Investigative Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
triethylcholine	DMUPK6G	Discovery agent	N.A.	Investigative	[2]

References

• [1] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 914).
• [2] The IUPHAR/BPS Guide to PHARMACOLOGY in 2018: updates and expansion to encompass the new guide to IMMUNOPHARMACOLOGY. Nucleic Acids Res. 2018 Jan 4;46(D1):D1091-D1106. (familyId=172)