Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTYBI73)

DTP Name Zinc transporter 10 (SLC30A10)
Gene Name SLC30A10
UniProt ID
Q6XR72 (ZNT10_HUMAN)
VARIDT ID
DTD0270
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms HMDPC; HMNDYT1; Manganese transporter SLC30A10; SLC30A10; Solute carrier family 30 member 10; ZNT10; ZnT-10
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Tissue Specificity Specifically expressed in fetal liver andfetal brain (PubMed:15154973). Expressed in adult tissues withrelative levels small intestine > liver > testes > brain > ovary >colon > cervix > prostate > placenta (PubMed:22706290).
Sequence
MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG
VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA
DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG
VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK
ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ
DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV
NRTHF
Function
This transporter mediates the effux of manganese and confers protection against manganese-induced cell death, plays a pivotal role in manganese transport. Also acts as zinc transporter involved in zinc homeostasis. Seems to mediate zinc transport into early endosomes and recycling endosomes to prevent zinc toxicity; the function may be regulated by heterodimerization with other zinc transporters of the SLC30A subfamily. May be involved in regulation of zinc-dependent senescence of vascular smooth muscle cells.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.2.5
Gene ID
55532
Reactome Pathway
Metal ion SLC transporters (R-HSA-425410 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.22E-03 -5.14E-02 -2.45E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.02E-09 5.73E-01 1.71E+00
Alopecia ED70 Skin from scalp 3.40E-03 6.96E-01 9.01E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.84E-02 -8.25E-02 -2.17E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.79E-01 -2.25E-03 -1.43E-02
Aortic stenosis BB70 Calcified aortic valve 8.80E-01 1.12E-01 2.58E-01
Apnea 7A40 Hyperplastic tonsil 7.39E-01 -1.76E-02 -1.02E-01
Arthropathy FA00-FA5Z Peripheral blood 6.69E-01 -3.76E-03 -2.49E-02
Asthma CA23 Nasal and bronchial airway 5.29E-01 -8.00E-03 -2.63E-02
Atopic dermatitis EA80 Skin 5.55E-01 -1.52E-03 -4.30E-03
Autism 6A02 Whole blood 5.48E-01 -4.64E-02 -2.71E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.92E-01 6.71E-02 4.52E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.56E-01 -1.77E-03 -1.48E-02
Bacterial infection of gingival 1C1H Gingival tissue 3.38E-01 -6.92E-03 -3.95E-02
Batten disease 5C56.1 Whole blood 1.01E-01 8.98E-02 1.40E+00
Behcet's disease 4A62 Peripheral blood 4.49E-01 2.79E-02 1.88E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.57E-04 1.96E-01 8.55E-01
Bladder cancer 2C94 Bladder tissue 2.27E-07 6.74E-01 4.52E+00
Breast cancer 2C60-2C6Z Breast tissue 5.83E-07 -7.46E-02 -2.89E-01
Cardioembolic stroke 8B11.20 Whole blood 1.61E-02 6.80E-02 4.92E-01
Cervical cancer 2C77 Cervical tissue 2.84E-01 -2.25E-01 -6.98E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.28E-01 -3.83E-02 -2.24E-01
Chronic hepatitis C 1E51.1 Whole blood 6.60E-02 8.60E-02 4.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.91E-02 8.75E-02 5.11E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.26E-01 4.76E-02 3.24E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.39E-01 7.07E-02 5.00E-01
Colon cancer 2B90 Colon tissue 5.99E-72 -3.67E+00 -2.74E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.42E-01 -6.36E-02 -4.77E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.62E-01 5.04E-02 2.25E-01
Endometriosis GA10 Endometrium tissue 1.06E-02 3.73E-02 2.02E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.96E-01 -3.72E-02 -2.38E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.48E-04 -2.45E-01 -1.37E+00
Gastric cancer 2B72 Gastric tissue 1.33E-01 2.58E-02 1.25E-01
Glioblastopma 2A00.00 Nervous tissue 3.56E-14 -4.23E-01 -8.07E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.83E-01 -3.37E-01 -5.58E-01
Head and neck cancer 2D42 Head and neck tissue 5.52E-01 4.21E-03 3.19E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.05E-01 1.44E-01 5.62E-01
Huntington's disease 8A01.10 Whole blood 6.37E-01 -4.45E-02 -4.43E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.17E-01 -1.35E-01 -8.34E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.19E-01 3.34E-02 1.71E-01
Influenza 1.00E+30 Whole blood 2.17E-01 1.81E-01 1.20E+00
Interstitial cystitis GC00.3 Bladder tissue 2.76E-01 -3.11E-02 -9.38E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.01E-01 1.85E-01 8.82E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.42E-04 4.93E-01 8.31E-01
Ischemic stroke 8B11 Peripheral blood 8.37E-01 1.17E-03 7.72E-03
Juvenile idiopathic arthritis FA24 Peripheral blood 4.53E-01 -2.16E-02 -4.49E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.87E-02 1.42E-01 5.03E-01
Lateral sclerosis 8B60.4 Skin 5.57E-02 1.98E-01 1.68E+00
Liver cancer 2C12.0 Liver tissue 9.97E-03 4.07E-01 9.37E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.74E-04 -2.44E+00 -4.25E+00
Lung cancer 2C25 Lung tissue 2.20E-05 2.27E-02 1.44E-01
Lupus erythematosus 4A40 Whole blood 5.61E-01 1.26E-02 4.61E-02
Major depressive disorder 6A70-6A7Z Whole blood 7.77E-02 5.11E-02 2.06E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.12E-01 -1.11E-02 -4.60E-02
Melanoma 2C30 Skin 7.78E-04 -7.58E-01 -5.15E-01
Multiple myeloma 2A83.1 Bone marrow 1.80E-02 -4.87E-01 -1.14E+00
Multiple myeloma 2A83.1 Peripheral blood 4.37E-02 1.77E-01 1.43E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.04E-01 -2.64E-02 -9.89E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.16E-01 -3.86E-02 -2.96E-01
Myelofibrosis 2A20.2 Whole blood 8.09E-02 6.97E-02 5.39E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.77E-01 -1.02E-01 -1.53E-01
Myopathy 8C70.6 Muscle tissue 1.52E-01 8.02E-02 6.34E-01
Neonatal sepsis KA60 Whole blood 1.61E-06 1.14E-01 7.19E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.58E-01 -4.85E-01 -9.75E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.81E-01 3.47E-02 6.63E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.94E-01 -2.47E-02 -4.61E-01
Olive pollen allergy CA08.00 Peripheral blood 1.00E-02 2.05E-01 2.00E+00
Oral cancer 2B6E Oral tissue 8.39E-02 -6.87E-02 -3.00E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.91E-01 1.39E-03 6.37E-03
Osteoporosis FB83.1 Bone marrow 1.40E-01 -6.00E-02 -1.80E+00
Ovarian cancer 2C73 Ovarian tissue 1.56E-02 -4.14E-01 -9.34E-01
Pancreatic cancer 2C10 Pancreas 4.51E-01 -1.51E-01 -4.22E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.68E-02 -4.23E-01 -1.32E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.19E-01 7.29E-02 5.16E-01
Pituitary cancer 2D12 Pituitary tissue 7.19E-02 2.53E-01 1.11E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.75E-03 7.66E-01 3.44E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.88E-01 3.97E-02 3.39E-01
Polycythemia vera 2A20.4 Whole blood 1.65E-07 1.48E-01 1.07E+00
Pompe disease 5C51.3 Biceps muscle 6.82E-01 -5.14E-03 -1.76E-02
Preterm birth KA21.4Z Myometrium 8.99E-02 -6.32E-02 -1.22E+00
Prostate cancer 2C82 Prostate 7.31E-01 -1.45E-01 -4.05E-01
Psoriasis EA90 Skin 3.84E-09 -2.54E-01 -5.73E-01
Rectal cancer 2B92 Rectal colon tissue 1.13E-03 -2.67E+00 -2.67E+00
Renal cancer 2C90-2C91 Kidney 1.39E-03 5.22E-02 2.82E-01
Retinoblastoma 2D02.2 Uvea 9.00E-01 -7.79E-02 -6.54E-01
Rheumatoid arthritis FA20 Synovial tissue 4.54E-01 -2.32E-02 -1.02E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.74E-01 3.47E-02 2.68E-01
Schizophrenia 6A20 Prefrontal cortex 2.86E-01 -1.17E-01 -1.72E-01
Schizophrenia 6A20 Superior temporal cortex 1.10E-01 3.59E-02 1.87E-01
Scleroderma 4A42.Z Whole blood 1.88E-03 2.40E-01 1.57E+00
Seizure 8A60-8A6Z Whole blood 9.31E-01 2.98E-03 1.93E-02
Sensitive skin EK0Z Skin 3.82E-01 -6.66E-02 -1.86E-01
Sepsis with septic shock 1G41 Whole blood 8.73E-16 1.51E-01 8.37E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.78E-02 2.81E-01 1.05E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.60E-01 9.13E-03 5.44E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 4.75E-01 1.78E-02 1.86E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.99E-03 1.06E-01 2.65E+00
Skin cancer 2C30-2C3Z Skin 4.72E-05 -1.67E-01 -2.54E-01
Thrombocythemia 3B63 Whole blood 8.57E-03 2.07E-01 1.45E+00
Thrombocytopenia 3B64 Whole blood 6.48E-01 -5.44E-02 -3.54E-01
Thyroid cancer 2D10 Thyroid 9.58E-01 -5.84E-03 -2.87E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.97E-01 -2.84E-02 -1.77E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.87E-01 -4.77E-02 -1.74E-01
Type 2 diabetes 5A11 Liver tissue 3.59E-01 6.02E-01 9.64E-01
Ureter cancer 2C92 Urothelium 5.21E-01 -3.64E-02 -2.71E-01
Uterine cancer 2C78 Endometrium tissue 5.99E-02 7.06E-02 1.86E-01
Vitiligo ED63.0 Skin 9.68E-01 -5.89E-01 -7.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Mutations in SLC30A10 cause parkinsonism and dystonia with hypermanganesemia, polycythemia, and chronic liver disease. Am J Hum Genet. 2012 Mar 9;90(3):467-77.