Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTZ6IJW)

DTP Name Zinc transporter ZIP14 (SLC39A14)
Gene Name SLC39A14
UniProt ID
Q15043 (S39AE_HUMAN)
VARIDT ID
DTD0342
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms HCIN; HMNDYT2; KIAA0062; LIV-1 subfamily of ZIP zinc transporter 4; LZT-Hs4; NET34; SLC39A14; Solute carrier family 39 member 14; ZIP-14; ZIP14; Zinc transporter ZIP14; cig19
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Tissue Specificity Expressed in liver and in brain by largeneurons in the globus pallidus, the insular cortex and the dentatenucleus and to a lower extent in the putamen and the caudatenucleus (at protein level) (PubMed:27231142). Isoform 1 isubiquitously expressed, with increased expression in liver,pancreas, fetal liver, thyroid gland, left and right ventricle,right atrium and fetal heart. Weakly expressed in spleen, thymus,and peripheral blood leukocytes (PubMed:15642354, PubMed:7584044,PubMed:27231142). Isoform 3 is widely expressed but not detectedin brain, heart, skeletal muscle and fetal skin (PubMed:27231142).Expressed in osteoblasts and giant osteoclast-like cells, but notin osteocytes found osteoblastoma and giant cell tumors (atprotein level) (PubMed:29621230).
Sequence
MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSLGAPAISAASFLQDLIHRYGEGDSLTLQ
QLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPT
ILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKK
TFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPLEDYYVSKSAVVFGGFYLFFFTEKI
LKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPM
VDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFT
VSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAG
SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKGSILIPFIIQNLGLLTGFTIMV
VLTMYSGQIQIG
Function This transporter is broad-scope metal ion transporter with a preference for zinc uptake and also mediates cellular uptake of nontransferrin-bound iron.
Endogenous Substrate(s) Cd2+; Mn2+; Zn2+
TCDB ID
2.A.5.4.5
Gene ID
23516
KEGG Pathway
Ferroptosis (hsa04216 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Reactome Pathway
Zinc influx into cells by the SLC39 gene family (R-HSA-442380 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.30E-10 1.64E-01 6.61E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.90E-03 3.50E-01 8.26E-01
Alopecia ED70 Skin from scalp 4.11E-01 -4.67E-02 -2.25E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.11E-03 -2.81E-01 -4.17E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.24E-01 4.00E-02 3.55E-01
Aortic stenosis BB70 Calcified aortic valve 5.18E-01 2.10E-01 3.37E-01
Apnea 7A40 Hyperplastic tonsil 8.03E-01 5.21E-04 2.30E-03
Arthropathy FA00-FA5Z Peripheral blood 6.48E-01 -3.78E-02 -2.29E-01
Asthma CA23 Nasal and bronchial airway 4.50E-02 -9.37E-02 -2.23E-01
Atopic dermatitis EA80 Skin 2.54E-02 -1.12E-01 -7.10E-01
Autism 6A02 Whole blood 4.83E-01 -1.73E-02 -7.50E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.08E-03 -3.84E-01 -2.63E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.61E-01 9.32E-02 3.72E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.62E-10 4.94E-01 1.11E+00
Batten disease 5C56.1 Whole blood 8.18E-01 -3.51E-02 -2.34E-01
Behcet's disease 4A62 Peripheral blood 7.30E-01 -4.92E-02 -2.13E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.59E-01 -7.89E-02 -3.29E-01
Bladder cancer 2C94 Bladder tissue 5.66E-01 1.96E-01 3.01E-01
Breast cancer 2C60-2C6Z Breast tissue 7.83E-03 8.78E-02 2.07E-01
Cardioembolic stroke 8B11.20 Whole blood 5.28E-02 1.56E-01 7.77E-01
Cervical cancer 2C77 Cervical tissue 7.97E-01 -1.32E-02 -5.59E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.73E-03 1.97E-01 1.01E+00
Chronic hepatitis C 1E51.1 Whole blood 1.86E-01 8.11E-02 5.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.55E-01 9.78E-02 2.54E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.44E-03 -6.77E-02 -3.53E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.84E-01 -1.71E-02 -1.88E-01
Colon cancer 2B90 Colon tissue 1.04E-20 -9.10E-01 -1.07E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.99E-01 -5.58E-01 -8.04E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.26E-01 -1.08E-01 -5.79E-01
Endometriosis GA10 Endometrium tissue 9.33E-01 2.43E-01 1.95E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.85E-01 -7.83E-02 -5.95E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.70E-04 -4.93E-01 -1.50E+00
Gastric cancer 2B72 Gastric tissue 4.63E-01 1.94E-01 3.93E-01
Glioblastopma 2A00.00 Nervous tissue 1.65E-02 -5.23E-02 -8.94E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.10E-05 -5.31E-01 -1.99E+00
Head and neck cancer 2D42 Head and neck tissue 6.44E-29 6.15E-01 2.32E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.12E-02 -1.59E-01 -7.95E-01
Huntington's disease 8A01.10 Whole blood 9.42E-01 -1.21E-02 -1.27E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.59E-01 6.04E-02 8.30E-02
Immunodeficiency 4A00-4A20 Peripheral blood 1.29E-03 1.82E-01 2.03E+00
Influenza 1.00E+30 Whole blood 2.97E-04 -3.73E-01 -6.52E+00
Interstitial cystitis GC00.3 Bladder tissue 2.45E-01 9.42E-02 7.14E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.47E-01 1.55E-01 6.18E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.54E-02 2.13E-01 4.48E-01
Ischemic stroke 8B11 Peripheral blood 3.65E-01 -1.42E-02 -1.25E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.45E-02 6.55E-02 2.12E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.29E-01 1.38E-01 6.23E-01
Lateral sclerosis 8B60.4 Skin 5.22E-02 -1.22E-01 -5.40E-01
Liver cancer 2C12.0 Liver tissue 4.61E-05 -1.05E+00 -5.86E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.02E-07 -1.57E+00 -5.64E+00
Lung cancer 2C25 Lung tissue 9.55E-01 -7.67E-02 -1.77E-01
Lupus erythematosus 4A40 Whole blood 8.23E-01 -1.76E-02 -5.51E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.41E-01 -4.24E-02 -1.49E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.56E-01 3.05E-02 1.20E-01
Melanoma 2C30 Skin 2.41E-01 5.65E-01 5.15E-01
Multiple myeloma 2A83.1 Bone marrow 2.90E-01 1.12E-02 4.06E-02
Multiple myeloma 2A83.1 Peripheral blood 9.12E-01 3.24E-02 8.88E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.12E-01 -2.30E-02 -1.17E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.60E-01 -1.04E-02 -6.02E-02
Myelofibrosis 2A20.2 Whole blood 4.58E-01 -6.56E-02 -4.23E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.77E-01 8.27E-02 1.37E-01
Myopathy 8C70.6 Muscle tissue 9.57E-01 2.28E-01 2.80E-01
Neonatal sepsis KA60 Whole blood 8.14E-01 1.76E-03 7.47E-03
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.12E-05 -5.63E-01 -2.27E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.71E-01 1.50E-01 9.65E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.70E-01 1.03E-01 4.54E-01
Olive pollen allergy CA08.00 Peripheral blood 4.56E-01 1.85E-01 6.24E-01
Oral cancer 2B6E Oral tissue 1.56E-01 2.48E-02 8.39E-02
Osteoarthritis FA00-FA0Z Synovial tissue 1.08E-01 9.25E-01 1.52E+00
Osteoporosis FB83.1 Bone marrow 2.18E-01 1.27E+00 2.48E+00
Ovarian cancer 2C73 Ovarian tissue 8.74E-01 1.44E-01 1.39E-01
Pancreatic cancer 2C10 Pancreas 5.70E-01 3.30E-01 1.68E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.64E-01 1.07E-01 3.92E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.10E-02 6.07E-02 5.92E-01
Pituitary cancer 2D12 Pituitary tissue 9.56E-01 -4.57E-02 -5.18E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.62E-01 6.01E-02 6.59E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.42E-02 7.11E-02 4.50E-01
Polycythemia vera 2A20.4 Whole blood 3.42E-02 -7.68E-02 -4.97E-01
Pompe disease 5C51.3 Biceps muscle 4.90E-01 -9.90E-02 -3.52E-01
Preterm birth KA21.4Z Myometrium 6.28E-02 -6.07E-01 -7.56E-01
Prostate cancer 2C82 Prostate 3.96E-02 -4.31E-01 -5.28E-01
Psoriasis EA90 Skin 5.18E-08 -3.23E-01 -5.91E-01
Rectal cancer 2B92 Rectal colon tissue 5.25E-01 1.12E-01 2.61E-01
Renal cancer 2C90-2C91 Kidney 7.08E-01 1.91E-01 1.84E-01
Retinoblastoma 2D02.2 Uvea 2.85E-05 -3.26E-01 -2.51E+00
Rheumatoid arthritis FA20 Synovial tissue 4.32E-10 2.42E+00 7.41E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.50E-01 -2.84E-02 -2.04E-01
Schizophrenia 6A20 Prefrontal cortex 5.90E-01 -7.61E-03 -2.57E-02
Schizophrenia 6A20 Superior temporal cortex 8.01E-01 -3.66E-02 -2.18E-01
Scleroderma 4A42.Z Whole blood 7.74E-01 4.16E-02 1.96E-01
Seizure 8A60-8A6Z Whole blood 4.81E-01 1.59E-01 7.86E-01
Sensitive skin EK0Z Skin 8.87E-01 6.34E-02 3.56E-01
Sepsis with septic shock 1G41 Whole blood 4.98E-03 -7.78E-02 -3.03E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.16E-01 1.79E-01 4.01E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.63E-02 2.54E-01 1.51E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.19E-02 1.52E-01 2.75E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.02E-01 -1.80E-01 -8.39E-01
Skin cancer 2C30-2C3Z Skin 4.01E-01 -1.22E-01 -2.06E-01
Thrombocythemia 3B63 Whole blood 7.90E-01 -4.57E-03 -3.04E-02
Thrombocytopenia 3B64 Whole blood 7.45E-01 -1.68E-01 -1.21E+00
Thyroid cancer 2D10 Thyroid 2.63E-19 -1.37E+00 -1.31E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.53E-01 -5.22E-02 -2.28E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.08E-02 -2.89E-01 -2.55E+00
Type 2 diabetes 5A11 Liver tissue 6.59E-01 -9.55E-03 -2.01E-02
Ureter cancer 2C92 Urothelium 7.28E-01 1.34E-02 9.04E-02
Uterine cancer 2C78 Endometrium tissue 1.02E-04 -2.31E-01 -2.23E-01
Vitiligo ED63.0 Skin 4.58E-01 -1.14E-01 -4.47E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 SLC39A14 deficiency alters manganese homeostasis and excretion resulting in brain manganese accumulation and motor deficits in mice. Proc Natl Acad Sci U S A. 2018 Feb 20;115(8):E1769-E1778.