Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT09I7D)

• DTT Name: Solute carrier family 19 member 1 (SLC19A1)
• Synonyms: Reduced folate carrier protein; RFC1; RFC; Placental folate transporter; Intestinal folate carrier 1; IFC-1; Folate transporter 1; FOLT; FLOT1
• Gene Name: SLC19A1
• DTT Type: Successful target; [1]
• Related Disease:
  Folate deficiency anaemia [ICD-11: 3A02]
  Leukaemia [ICD-11: 2A60-2B33]
  Nutritional deficiency [ICD-11: 5B50-5B71]
• UniProt ID: S19A1_HUMAN
• TTD ID: T35465
• Sequence:
  MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFT
  REQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQ
  LMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRV
  SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGH
  ALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN
  SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPS
  SIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
  VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKA
  AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPV
  TTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ
• Function: Transporter for the intake of folate. Uptake of folate in human placental choriocarcinoma cells occurs by a novel mechanism called potocytosis which functionally couples three components, namely the folate receptor, the folate transporter, and a V-type H(+)-pump.
• Reactome Pathway: Metabolism of folate and pterines (R-HSA-196757)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Folic acid	DMEMBJC	Folate-deficiency anemia	3A02.Y	Approved	[1]
Methotrexate	DM2TEOL	leukaemia	2A60-2B33	Approved	[1]

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Folate transporter 1 (SLC19A1) DTP Info
• Gene Name: SLC19A1

4 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Folic acid	DMEMBJC	Folate-deficiency anemia	3A02.Y	Approved	[2]
Methotrexate	DM2TEOL	leukaemia	2A60-2B33	Approved	[2]
Pemetrexed	DMMX2E6	Malignant pleural mesothelioma	2C26.0	Approved	[2]
Pralatrexate	DMAO80I	Breast cancer	2C60-2C65	Approved	[3]

References

• [1] Increased activity of a novel low pH folate transporter associated with lipophilic antifolate resistance in chinese hamster ovary cells. J Biol Chem. 1998 Apr 3;273(14):8106-11.
• [2] Biology of the major facilitative folate transporters SLC19A1 and SLC46A1. Curr Top Membr. 2014;73:175-204.
• [3] Antifolates in cancer therapy: structure, activity and mechanisms of drug resistance. Drug Resist Updat. 2012 Aug;15(4):183-210.