Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT09NOX)

• DTT Name: Plasmodium Dihydroorotase (Malaria dho)
• Synonyms: Dihydroorotase
• Gene Name: Malaria dho
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Carbon-nitrogen hydrolase
• UniProt ID: A9CSR1_PLAFA
• TTD ID: T70065
• EC Number: EC 3.5.2.3
• Sequence:
  MKNYFYIPIADDMHCHLRQGDMLDFTVNSIRRGGCNRVLVMPNTHPIISTCSDAQKYLYQ
  LKSRDDDIEYLMTLYLNKNTDENDILSNYYKCNLQGVKIYPSNVTTNSSDGITSLEPYYK
  VFHALEKLNKSIHIHCEEPNINPLYAEEKYLPHIHDLAIKFPGLNIVLEHISSSESINVI
  KEFRNVAGSITPHHLYLTIDDVVNMDIYDHAIDNTYIEKYIKNTYHYCKPLPKLLEDKIA
  LQDVIKDDFPRVFLGSDSAPHYKVMKRKPYYKPGIYTQPFLINYVAHILNKFDALDKMEN
  FTSKNASLFLNLAEKKKLAKYYICVEKHPFKLPREYNGVVPFLAGKTLDYDIHYVSKF
• Function: A Zn2+ amidohydrolase superfamily that catalyzes reversible cyclization of N-carbamoyl-L-aspartate (L-CA) to form L-dihydroorotate (L-DHO).

Molecular Interaction Atlas (MIA) of This DTT

8 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
5-bromo orotate	DM0HCG6	Discovery agent	N.A.	Investigative	[1]
5-Fluoro orotate	DMLSC10	Discovery agent	N.A.	Investigative	[1]
5-iodo orotate	DMDKFIO	Discovery agent	N.A.	Investigative	[1]
5-methyl orotate	DMYNFIP	Discovery agent	N.A.	Investigative	[1]
Dihydroorotate	DM76BGZ	Discovery agent	N.A.	Investigative	[2]
Lysine Nz-Carboxylic Acid	DMW1YK3	Discovery agent	N.A.	Investigative	[2]
N-Carbamoyl-L-Aspartate	DMJ13TR	Discovery agent	N.A.	Investigative	[2]
Orotate	DMMB29S	Discovery agent	N.A.	Investigative	[1]

References

• [1] Antimalarial activity of orotate analogs that inhibit dihydroorotase and dihydroorotate dehydrogenase. Biochem Pharmacol. 1992 Mar 17;43(6):1295-301.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.