General Information of Drug Therapeutic Target (DTT) (ID: TT0F5HE)

DTT Name HUMAN janus kinase 2 (JAK-2)
Synonyms Tyrosine-protein kinase JAK2
Gene Name JAK2
BioChemical Class
Kinase
UniProt ID
JAK2_HUMAN
TTD ID
T87554
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 2.7.10.2
Sequence
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Function
Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO); or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins. Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain. Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated, dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. Part of a signaling cascade that is activated by increased cellular retinol and that leads to the activation of STAT5 (STAT5A or STAT5B). In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation. Plays a role in cell cycle by phosphorylating CDKN1B. Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin. Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications.
KEGG Pathway
EGFR tyrosine kinase inhibitor resistance (hsa01521 )
Chemokine signaling pathway (hsa04062 )
PI3K-Akt signaling pathway (hsa04151 )
Necroptosis (hsa04217 )
Signaling pathways regulating pluripotency of stem cells (hsa04550 )
JAK-STAT signaling pathway (hsa04630 )
Th1 and Th2 cell differentiation (hsa04658 )
Th17 cell differentiation (hsa04659 )
Cholinergic synapse (hsa04725 )
Prolactin signaling pathway (hsa04917 )
Adipocytokine signaling pathway (hsa04920 )
AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
Growth hormone synthesis, secretion and action (hsa04935 )
Leishmaniasis (hsa05140 )
Toxoplasmosis (hsa05145 )
Tuberculosis (hsa05152 )
Hepatitis B (hsa05161 )
Influenza A (hsa05164 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Pathways in cancer (hsa05200 )
Chemical carcinogenesis - receptor activation (hsa05207 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
MAPK3 (ERK1) activation (R-HSA-110056 )
MAPK1 (ERK2) activation (R-HSA-112411 )
Prolactin receptor signaling (R-HSA-1170546 )
Signaling by SCF-KIT (R-HSA-1433557 )
Signaling by Leptin (R-HSA-2586552 )
RMTs methylate histone arginines (R-HSA-3214858 )
Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988 )
RAF activation (R-HSA-5673000 )
RAF/MAP kinase cascade (R-HSA-5673001 )
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
IL-6-type cytokine receptor ligand interactions (R-HSA-6788467 )
Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 )
Signaling by BRAF and RAF1 fusions (R-HSA-6802952 )
Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 )
Cyclin D associated events in G1 (R-HSA-69231 )
Interferon gamma signaling (R-HSA-877300 )
Regulation of IFNG signaling (R-HSA-877312 )
Interleukin-20 family signaling (R-HSA-8854691 )
Interleukin-35 Signalling (R-HSA-8984722 )
Signaling by Erythropoietin (R-HSA-9006335 )
Interleukin-12 signaling (R-HSA-9020591 )
Interleukin-23 signaling (R-HSA-9020933 )
Interleukin-27 signaling (R-HSA-9020956 )
Erythropoietin activates Phosphoinositide-3-kinase (PI3K) (R-HSA-9027276 )
Erythropoietin activates Phospholipase C gamma (PLCG) (R-HSA-9027277 )
Erythropoietin activates STAT5 (R-HSA-9027283 )
Erythropoietin activates RAS (R-HSA-9027284 )
Interleukin receptor SHC signaling (R-HSA-912526 )
Signaling downstream of RAS mutants (R-HSA-9649948 )
Signaling by RAF1 mutants (R-HSA-9656223 )
Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants (R-HSA-9670439 )
Signaling by CSF3 (G-CSF) (R-HSA-9674555 )
Potential therapeutics for SARS (R-HSA-9679191 )
Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462 )
Growth hormone receptor signaling (R-HSA-982772 )
Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
Interleukin-6 signaling (R-HSA-1059683 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fedratinib DM4ZBK6 Myelofibrosis 2A20.2 Approved [1]
Ruxolitinib DM7Q98D Essential thrombocythemia 3B63.1Z Approved [2]
------------------------------------------------------------------------------------

References

1 TH17 responses in cytokine storm of COVID-19: An emerging target of JAK2 inhibitor Fedratinib. J Microbiol Immunol Infect. 2020 Mar 11. pii: S1684-1182(20)30065-7.
2 The Use of Anti-Inflammatory Drugs in the Treatment of People With Severe Coronavirus Disease 2019 (COVID-19): The Perspectives of Clinical Immunologists From China. Clin Immunol. 2020 May;214:108393.