General Information of Drug Therapeutic Target (DTT) (ID: TT0MV2T)

DTT Name Melanocortin receptor 1 (MC1R)
Synonyms Melanotropin receptor; Melanocyte-stimulating hormone receptor; Melanocortin-1 receptor; MSHR; MSH-R; MC1-R
Gene Name MC1R
DTT Type
Successful target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
MSHR_HUMAN
TTD ID
T35842
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
Function The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Receptor for MSH (alpha, beta and gamma) and ACTH.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Melanogenesis (hsa04916 )
Reactome Pathway
G alpha (s) signalling events (R-HSA-418555 )
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Afamelanotide DMVWHTG Erythropoietic porphyrias 5C58.12 Approved [2]
Bremelanotide DM20LIM Hypoactive sexual desire dysfunction HA00 Approved [3]
------------------------------------------------------------------------------------
3 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dersimelagon DMMO0SU Erythropoietic protoporphyria 5C58.12 Phase 3 [4]
PL8177 DML5V22 Ulcerative colitis DD71 Phase 2 [5]
AP-1030 DMBGA35 Metabolic disorder 5C50-5D2Z Phase 1/2 [6]
------------------------------------------------------------------------------------
36 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ac-dR[CEHdFRWC]-NH2 DM7XY41 Discovery agent N.A. Investigative [7]
Ac-His-D-Phe-Arg-2-Nal-NHCH3 DMAQR29 Discovery agent N.A. Investigative [8]
Ac-His-DPhe-Arg-Trp-NH2 DMMP0D8 Discovery agent N.A. Investigative [9]
Ac-Nle-c[Asp-His-DNaI(2')-Pro-Trp-Lys]-NH2 DMLYGPW Discovery agent N.A. Investigative [10]
Ac-Nle-c[Asp-His-DNal(2')-Pro-Trp-Lys]-NH2 DMOVI7Y Discovery agent N.A. Investigative [10]
Ac-R[CEHdFRWC]-NH2 DMBFUD0 Discovery agent N.A. Investigative [7]
Ac-Tyr-D-Phe-Arg-2-Nal-NHCH3 DMIH5CD Discovery agent N.A. Investigative [8]
Ac-YCit[CEHdFRWC]-NH2 DMAVPXL Discovery agent N.A. Investigative [7]
Ac-YK[CEHdFRWC]-NH2 DM5SJX8 Discovery agent N.A. Investigative [7]
Ac-YRC(Me)*EHdFRWC(Me)NH2 DMWJ8UR Discovery agent N.A. Investigative [7]
Ac-YRMEHdFRWG-NH2 DMN2UKC Discovery agent N.A. Investigative [7]
Ac-YRMEHdFRWGSPPKD-NH2 DMDH5B3 Discovery agent N.A. Investigative [7]
Ac-YR[CEH(d-2alpha-Nal)RWC]-NH2 DMVQ4KG Discovery agent N.A. Investigative [7]
Ac-YR[CEH(pCl-dF)RWC]-NH2 DM25JXM Discovery agent N.A. Investigative [7]
Ac-YR[CEH(pF-dF)RWC]-NH2 DMXCF9T Discovery agent N.A. Investigative [7]
Ac-YR[CEHdFRWC]-NH2 DMBMY73 Discovery agent N.A. Investigative [7]
Ac-YR[CEHdFRWC]SPPKD-NH2 DMDO468 Discovery agent N.A. Investigative [7]
Ac-YR[CEHFRWC]-NH2 DMH0EAI Discovery agent N.A. Investigative [7]
Ac-[CEHdFRWC]-NH2 DMRLOGP Discovery agent N.A. Investigative [7]
AEKKDEGPYRMEHFRWGSPPKD DMZ8SV3 Discovery agent N.A. Investigative [7]
AP-1189 DMRZMKT Atopic dermatitis EA80 Investigative [11]
C[CO-(CH2)2-CO-Nle-D-Nal(2)-Arg-Trp-Lys]-NH2 DMHARQX Discovery agent N.A. Investigative [12]
C[CO-2,3-pyrazine-CO-D-Nal(2)-Arg-Trp-Lys]-NH2 DM1VCJP Discovery agent N.A. Investigative [12]
C[CO-2,3-pyrazine-CO-D-Phe-Arg-Trp-Lys]-NH2 DM8AMGF Discovery agent N.A. Investigative [12]
C[CO-o-C6H4-CO-Pro-D-Nal(2)-Arg-Trp-Lys]-NH2 DMD6OW4 Discovery agent N.A. Investigative [12]
C[Nle-Arg-D-Nal(2')-Arg-Trp-Glu]-NH2 DMX7IVO Discovery agent N.A. Investigative [13]
C[Nle-Arg-D-Phe-Arg-Trp-Glu]-NH2 DMUESCH Discovery agent N.A. Investigative [13]
C[Nle-Gln-D-Nal(2')-Arg-Trp-Glu]-NH2 DMM19SJ Discovery agent N.A. Investigative [13]
C[Nle-Gln-D-Phe-Arg-Trp-Glu]-NH2 DMSGWZE Discovery agent N.A. Investigative [13]
C[Nle-Nle-D-Nal(2')-Arg-Trp-Glu]-NH2 DM73ZMG Discovery agent N.A. Investigative [13]
C[Nle-Val-D-Nal(2')-Arg-Trp-Glu]-NH2 DMSIGJW Discovery agent N.A. Investigative [13]
D-Phe-Arg-2-Nal-NHCH3 DMLK428 Discovery agent N.A. Investigative [14]
GPYRMEHFRWGSPPKD-NH2 DMLRTPH Discovery agent N.A. Investigative [7]
MT-II DMKT1DA Female sexual arousal dysfunction HA01.1 Investigative [15]
NDP-SYSMEHFRWGKPVG DMRV16G Discovery agent N.A. Investigative [7]
Tic-D-Phe-Arg-2-Nal-NHCH3 DMMFCHU Discovery agent N.A. Investigative [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 36 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Atopic dermatitis EA90 Skin 1.44E-06 0.41 2.15
------------------------------------------------------------------------------------

References

1 The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954.
2 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
3 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
4 Dersimelagon, a novel oral melanocortin 1 receptor agonist, demonstrates disease-modifying effects in preclinical models of systemic sclerosis. Arthritis Res Ther. 2022 Sep 1;24(1):210.
5 Pharmacokinetics of the Melanocortin Type 1 Receptor Agonist PL8177 After Subcutaneous Administration. Drugs R D. 2021 Dec;21(4):431-443.
6 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
7 Discovery of a beta-MSH-derived MC-4R selective agonist. J Med Chem. 2005 May 5;48(9):3095-8.
8 Design and synthesis of potent and selective 1,3,4-trisubstituted-2-oxopiperazine based melanocortin-4 receptor agonists. Bioorg Med Chem Lett. 2006 Sep 1;16(17):4668-73.
9 Discovery of prototype peptidomimetic agonists at the human melanocortin receptors MC1R and MC4R. J Med Chem. 1997 Jul 4;40(14):2133-9.
10 Substitution of arginine with proline and proline derivatives in melanocyte-stimulating hormones leads to selectivity for human melanocortin 4 rece... J Med Chem. 2009 Jun 25;52(12):3627-35.
11 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 282).
12 Structure-activity relationships of cyclic lactam analogues of alpha-melanocyte-stimulating hormone (alpha-MSH) targeting the human melanocortin-3 ... J Med Chem. 2008 Jan 24;51(2):187-95.
13 Development of cyclic gamma-MSH analogues with selective hMC3R agonist and hMC3R/hMC5R antagonist activities. J Med Chem. 2006 Mar 23;49(6):1946-52.
14 Design, synthesis, and evaluation of proline and pyrrolidine based melanocortin receptor agonists. A conformationally restricted dipeptide mimic ap... J Med Chem. 2006 Jul 27;49(15):4745-61.
15 Design of potent linear alpha-melanotropin 4-10 analogues modified in positions 5 and 10. J Med Chem. 1989 Jan;32(1):174-9.
16 Synthesis of Tic-D-Phe Psi[CH2-CH2] isostere and its use in the development of melanocortin receptor agonists. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1721-5.