Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT0NUFM)

• DTT Name: Glucagon (GCG)
• Synonyms: GRPP; GLP2; GLP1; GLP-1
• Gene Name: GCG
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Glucagon
• UniProt ID: GLUC_HUMAN
• TTD ID: T44919
• Sequence:
  MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
  DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
  AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
• Function: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
• KEGG Pathway:
  cAMP signaling pathway (hsa04024)
  Neuroactive ligand-receptor interaction (hsa04080)
  Thermogenesis (hsa04714)
  Insulin secretion (hsa04911)
  Glucagon signaling pathway (hsa04922)
• Reactome Pathway:
  Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676)
  Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1) (R-HSA-381771)
  G alpha (q) signalling events (R-HSA-416476)
  G alpha (s) signalling events (R-HSA-418555)
  Glucagon-type ligand receptors (R-HSA-420092)
  Synthesis, secretion, and deacylation of Ghrelin (R-HSA-422085)
  ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821)
  Glucagon signaling in metabolic regulation (R-HSA-163359)

Molecular Interaction Atlas (MIA) of This DTT

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
JNJ-64565111	DMVSUH1	Obesity	5B81	Phase 2	[1]
MEDI0382	DMSV60C	Type-2 diabetes	5A11	Phase 2	[1]
MK-8521	DMVNAYE	Type-2 diabetes	5A11	Phase 2	[1]
PB-1023	DMZCI04	Type-2 diabetes	5A11	Phase 2	[1]
PT320	DMZYKXN	Parkinson disease	8A00.0	Phase 2	[2]
SAR425899	DM53IPE	Diabetic complication	5A2Y	Phase 1	[1]
ZP2929	DMRVDUM	Type-1 diabetes	5A10	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [2] Sustained Release GLP-1 Agonist PT320 Delays Disease Progression in a Mouse Model of Parkinson's Disease. ACS Pharmacol Transl Sci. 2021 Mar 16;4(2):858-869.