Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT0OFWN)

DTT Name	Pseudomonas UDP-3-O-acyl-GlcNAc deacetylase (Pseudo lpxC)
Synonyms	Pseudo UDP-3-O-acyl-GlcNAc deacetylase; EnvA protein
Gene Name	Pseudo lpxC
DTT Type	Preclinical target	[1]
BioChemical Class	Carbon-nitrogen hydrolase
UniProt ID	LPXC_PSEAE
TTD ID	T85944
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 3.5.1.108
Sequence	MIKQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFCRTDLDPVVEIPARAENVGET TMSTTLVKGDVKVDTVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQ EQEAAKKFIRIKREVSVEEGDKRAVFVPFDGFKVSFEIDFDHPVFRGRTQQASVDFSSTS FVKEVSRARTFGFMRDIEYLRSQNLALGGSVENAIVVDENRVLNEDGLRYEDEFVKHKIL DAIGDLYLLGNSLIGEFRGFKSGHALNNQLLRTLIADKDAWEVVTFEDARTAPISYMRPA AAV
Function	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.
KEGG Pathway	Lipopolysaccharide biosynthesis (pae00540 ) Metabolic pathways (pae01100 )
BioCyc Pathway	PAER208964:G1FZ6-4492-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LpxC-1	DMV1A25	Acinetobacter baumannii infection	CA40.0Y	Preclinical	[2]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RC-01	DM4FNWO	Gram-negative bacterial infection	1B74-1G40	Terminated	[3]
------------------------------------------------------------------------------------

7 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
3-(heptyloxy)benzoic acid	DMQZU9G	Discovery agent	N.A.	Investigative	[4]
BB-78484	DMFBN9O	Discovery agent	N.A.	Investigative	[5]
BB-78485	DMJKA3F	Discovery agent	N.A.	Investigative	[5]
Cacodylate Ion	DMK4XLD	Discovery agent	N.A.	Investigative	[1]
MYRISTIC ACID	DMYX0BL	Discovery agent	N.A.	Investigative	[4]
Palmitoleic Acid	DM4W5X8	Discovery agent	N.A.	Investigative	[1]
Tu-514	DMUR0TF	Discovery agent	N.A.	Investigative	[1]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Investigative Drug(s)

References

1	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
2	Different drugs for bad bugs: antivirulence strategies in the age of antibiotic resistance. Nat Rev Drug Discov. 2017 Jul;16(7):457-471.
3	The global preclinical antibacterial pipeline. Nat Rev Microbiol. 2020 May;18(5):275-285.
4	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
5	Antibacterial activities and characterization of novel inhibitors of LpxC. Antimicrob Agents Chemother. 2002 Jun;46(6):1793-9.