Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT0R12H)
DTT Name | Neuron-specific vesicular protein calcyon (CALY) | ||||
---|---|---|---|---|---|
Synonyms | Neuronspecific vesicular protein calcyon; CALY | ||||
Gene Name | CALY | ||||
DTT Type |
Discontinued target
|
[1] | |||
Related Disease |
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ |
||||
Function | Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis. | ||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||