Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT10Y9E)

• DTT Name: Interleukin 2 receptor alpha (IL2RA)
• Synonyms: TAC antigen; Interleukin-2 receptor subunit alpha; IL2-RA; IL-2R subunit alpha; IL-2-RA; IL-2 receptor subunit alpha; IL-2 receptor alpha subunit; CD25 antigen; CD25
• Gene Name: IL2RA
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine receptor
• UniProt ID: IL2RA_HUMAN
• TTD ID: T03313
• Sequence:
  MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
  GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
  LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
  QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
  VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
• Function: The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells. Receptor for interleukin-2.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Endocytosis (hsa04144)
  PI3K-Akt signaling pathway (hsa04151)
  Jak-STAT signaling pathway (hsa04630)
  Hematopoietic cell lineage (hsa04640)
  Measles (hsa05162)
  HTLV-I infection (hsa05166)
• Reactome Pathway:
  G beta (R-HSA-392451)
  Interleukin-2 signaling (R-HSA-451927)
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin receptor SHC signaling (R-HSA-912526)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Basiliximab	DMWNRZT	Organ transplant rejection	NE84	Approved	[1]

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Inolimomab	DMUS1F8	Heart transplant rejection	NE84	Phase 3	[2]
LMB-2	DMG7RAV	Chronic lymphocytic leukaemia	2A82.0	Phase 2	[3]
RFT-5.dgA	DMQ8K93	Human immunodeficiency virus infection	1C62	Phase 2	[4]
CHT-25	DMJLZ8T	Hodgkin lymphoma	2B30	Phase 1	[5]
RG6292	DMBRYZ7	Solid tumour/cancer	2A00-2F9Z	Phase 1	[6]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
HuMax-TAC	DM8BSF3	Autoimmune diabetes	5A10	Terminated	[7]

References

• [1] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [2] Encouraging results with inolimomab (anti-IL-2 receptor) as treatment for refractory acute graft-versus-host disease.Biol Blood Marrow Transplant.2006 Nov;12(11):1135-41.
• [3] Phase I trial of recombinant immunotoxin anti-Tac(Fv)-PE38 (LMB-2) in patients with hematologic malignancies. J Clin Oncol. 2000 Apr;18(8):1622-36.
• [4] Clinical evaluation of ricin A-chain immunotoxins in patients with Hodgkin's lymphoma. Ann Oncol. 2003 May;14(5):729-36.
• [5] A Phase I Clinical Trial of CHT-25 a 131I-Labeled Chimeric Anti-CD25 Antibody Showing Efficacy in Patients with Refractory Lymphoma. Clin Cancer Res. 2009 Dec 15;15(24):7701-7710.
• [6] Clinical pipeline report, company report or official report of Roche.
• [7] Biosynthesis, synthesis, and biological activities of pyrrolobenzodiazepines. Med Res Rev. 2012 Mar;32(2):254-93.