Details of the Drug

General Information of Drug (ID: DMWNRZT)

Drug Name

Basiliximab

Synonyms

Simulect (TN)

Indication

Disease Entry	ICD 11	Status	REF
Organ transplant rejection	NE84	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Immunomodulatory Agents

Drug Type

Monoclonal antibody

Sequence

>heavy chain
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQ
KFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPPKSCDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
QIVSTQSPAIMSASPGEKVTMTCSASSSRSYMQWYQQKPGTSPKRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK
ADYEKHKVYACEVTHQGLSSPVTKSFNRGE

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 7.2 +/- 3.2 days (adults) [2]
Metabolism: The drug is metabolized via opsonization via the reticuloendothelial system []
Vd: The volume of distribution (Vd) of drug is 7.8 +/- 5.1 L in pediatric and 4.8 +/- 2.1 L in adult []

Cross-matching ID

DrugBank ID: DB00074
TTD ID: D06SBB

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interleukin 2 receptor alpha (IL2RA)	TT10Y9E	IL2RA_HUMAN	Modulator	[3]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Basiliximab

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Azathioprine.	Transplant rejection [NE84]	[4]
-----------

Coadministration of a Drug Treating the Disease Different from Basiliximab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Roflumilast.	Asthma [CA23]	[5]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Basiliximab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[6]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Denosumab.	Low bone mass disorder [FB83]	[7]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Basiliximab and Cladribine.	Mature B-cell leukaemia [2A82]	[5]
Alemtuzumab	DMZL3IV	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Alemtuzumab.	Mature B-cell leukaemia [2A82]	[8]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Tecfidera.	Multiple sclerosis [8A40]	[9]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Basiliximab and Siponimod.	Multiple sclerosis [8A40]	[4]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Basiliximab and Fingolimod.	Multiple sclerosis [8A40]	[10]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Ocrelizumab.	Multiple sclerosis [8A40]	[11]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Basiliximab and Ozanimod.	Multiple sclerosis [8A40]	[5]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[12]
Efalizumab	DMCKL5V	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Efalizumab.	Psoriasis [EA90]	[13]
Canakinumab	DM8HLO5	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Canakinumab.	Rheumatoid arthritis [FA20]	[14]
Rilonacept	DMGLUQS	Moderate	Additive immunosuppressive effects by the combination of Basiliximab and Rilonacept.	Rheumatoid arthritis [FA20]	[14]
Golimumab	DMHZV7X	Major	Additive immunosuppressive effects by the combination of Basiliximab and Golimumab.	Rheumatoid arthritis [FA20]	[15]
Leflunomide	DMR8ONJ	Major	Additive immunosuppressive effects by the combination of Basiliximab and Leflunomide.	Rheumatoid arthritis [FA20]	[6]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Basiliximab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[16]
-----------


⏷ Show the Full List of 17 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6879).
2	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
4	Cerner Multum, Inc. "Australian Product Information.".
5	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
6	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
7	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
8	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
9	Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
10	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
11	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
12	Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
13	Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
14	Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
15	Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
16	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]