Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT13TL0)
DTT Name | Interferon gamma receptor (IFNGR2) | ||||
---|---|---|---|---|---|
Synonyms |
Interferon gamma transducer 1; Interferon gamma receptor beta-chain; Interferon gamma receptor accessory factor 1; Interferon gamma receptor 2; IFNGT1; IFNGR; IFN-gamma-R2; IFN-gamma-R-beta; IFN-gamma-R; IFN-gamma receptor 2; CDw119; CD119; AF-1
|
||||
Gene Name | IFNGR2 | ||||
DTT Type |
Successful target
|
[1] | |||
BioChemical Class |
Cytokine receptor
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRP
VVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELG ALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYW EKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMAD ASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQ PILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL |
||||
Function |
Ligand binding stimulates activation of the JAK/STAT signaling pathway. Required for signal transduction in contrast to other receptor subunit responsible for ligand binding. Associates with IFNGR1 to form a receptor for the cytokine interferon gamma (IFNG) (, ,).
|
||||
KEGG Pathway |
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||