Details of the Drug

General Information of Drug (ID: DMWUMRL)

Drug Name

Interferon gamma-1b

Indication

Disease Entry	ICD 11	Status	REF
Chronic granulomatous disease	4A00.0Y	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Immunomodulatory Agents

Sequence

CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLF
KNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM
AELSPAAKTGKRKRSQMLFRGRRASQ

Adverse Drug Reaction (ADR)

ADR Term	Variation	Related DOT	DOT ID	REF
Agitation	Not Available	GRIN3A	OTQS9GYY	[2]
Apoptosis	Not Available	NOS1	OT7M8XVG	[2]
-----------

Cross-matching ID

DrugBank ID: DB00033
TTD ID: D0U8US

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interferon gamma receptor (IFNGR2)	TT13TL0	INGR2_HUMAN	Binder	[3]

------------------------------------------------------------------------------------

Drug Off-Target (DOT)

DOT Name	DOT ID	UniProt ID	Interaction	REF
Glutamate receptor ionotropic, NMDA 3A (GRIN3A)	OTQS9GYY	NMD3A_HUMAN	Drug Response	[2]
Nitric oxide synthase 1 (NOS1)	OT7M8XVG	NOS1_HUMAN	Drug Response	[2]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Interferon gamma-1b (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Remdesivir	DMBFZ6L	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Remdesivir.	1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019]	[4]
Thioguanine	DM7NKEV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Thioguanine.	Acute myeloid leukaemia [2A60]	[5]
Bedaquiline	DM3906J	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Bedaquiline.	Antimicrobial drug resistance [MG50-MG52]	[6]
Aminophylline	DML2NIB	Moderate	Decreased metabolism of Interferon gamma-1b caused by Aminophylline mediated inhibition of CYP450 enzyme.	Asthma [CA23]	[4]
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Roflumilast.	Asthma [CA23]	[7]
Pexidartinib	DMS2J0Z	Major	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Pexidartinib.	Bone/articular cartilage neoplasm [2F7B]	[8]
Oxtriphylline	DMLHSE3	Moderate	Decreased metabolism of Interferon gamma-1b caused by Oxtriphylline mediated inhibition of CYP450 enzyme.	Cough [MD12]	[4]
PMID27977313-Compound-29	DMIF7KG	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and PMID27977313-Compound-29.	Discovery agent [N.A.]	[9]
PMID28870136-Compound-48	DMPIM9L	Moderate	Decreased metabolism of Interferon gamma-1b caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme.	Discovery agent [N.A.]	[4]
Cannabidiol	DM0659E	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Cannabidiol.	Epileptic encephalopathy [8A62]	[7]
Brentuximab vedotin	DMWLC57	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[10]
Efavirenz	DMC0GSJ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Efavirenz.	Human immunodeficiency virus disease [1C60-1C62]	[11]
Mipomersen	DMGSRN1	Major	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Mipomersen.	Hyper-lipoproteinaemia [5C80]	[12]
Teriflunomide	DMQ2FKJ	Major	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[13]
BMS-201038	DMQTAGO	Major	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and BMS-201038.	Hyper-lipoproteinaemia [5C80]	[14]
Polyethylene glycol	DM4I1JP	Moderate	Increased risk of lowers seizure threshold by the combination of Interferon gamma-1b and Polyethylene glycol.	Irritable bowel syndrome [DD91]	[15]
Methotrexate	DM2TEOL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Methotrexate.	Leukaemia [2A60-2B33]	[7]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Denosumab.	Low bone mass disorder [FB83]	[16]
Calaspargase pegol	DMQZBXI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Calaspargase pegol.	Malignant haematopoietic neoplasm [2B33]	[9]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Cladribine.	Mature B-cell leukaemia [2A82]	[7]
Idelalisib	DM602WT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Idelalisib.	Mature B-cell leukaemia [2A82]	[17]
Alemtuzumab	DMZL3IV	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Alemtuzumab.	Mature B-cell leukaemia [2A82]	[18]
Clofarabine	DMCVJ86	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Clofarabine.	Mature B-cell lymphoma [2A85]	[19]
Interferon beta-1a	DM1A6RV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Interferon beta-1a.	Multiple sclerosis [8A40]	[20]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Tecfidera.	Multiple sclerosis [8A40]	[21]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Siponimod.	Multiple sclerosis [8A40]	[4]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Fingolimod.	Multiple sclerosis [8A40]	[22]
Interferon beta-1b	DMCN61Z	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Interferon beta-1b.	Multiple sclerosis [8A40]	[20]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Ocrelizumab.	Multiple sclerosis [8A40]	[23]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Ozanimod.	Multiple sclerosis [8A40]	[7]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[24]
Bupropion	DM5PCS7	Major	Increased risk of lowers seizure threshold by the combination of Interferon gamma-1b and Bupropion.	Nicotine use disorder [6C4A]	[25]
Tramadol	DMRQD04	Major	Increased risk of lowers seizure threshold by the combination of Interferon gamma-1b and Tramadol.	Pain [MG30-MG3Z]	[26]
Ropinirole	DMA6S1D	Moderate	Decreased metabolism of Interferon gamma-1b caused by Ropinirole mediated inhibition of CYP450 enzyme.	Parkinsonism [8A00]	[27]
Lindane	DMB8CNL	Moderate	Increased risk of lowers seizure threshold by the combination of Interferon gamma-1b and Lindane.	Pediculosis [1G00]	[28]
Leflunomide	DMR8ONJ	Major	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Leflunomide.	Rheumatoid arthritis [FA20]	[13]
Pimozide	DMW83TP	Moderate	Decreased metabolism of Interferon gamma-1b caused by Pimozide mediated inhibition of CYP450 enzyme.	Schizophrenia [6A20]	[29]
Trabectedin	DMG3Y89	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Trabectedin.	Solid tumour/cancer [2A00-2F9Z]	[7]
Epirubicin	DMPDW6T	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Epirubicin.	Solid tumour/cancer [2A00-2F9Z]	[4]
Naltrexone	DMUL45H	Moderate	Increased risk of hepatotoxicity by the combination of Interferon gamma-1b and Naltrexone.	Substance abuse [6C40]	[30]
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Interferon gamma-1b and Azathioprine.	Transplant rejection [NE84]	[4]
Ganciclovir	DM1MBYQ	Moderate	Additive myelosuppressive effects by the combination of Interferon gamma-1b and Ganciclovir.	Virus infection [1A24-1D9Z]	[4]
Valganciclovir	DMS2IUH	Moderate	Additive myelosuppressive effects by the combination of Interferon gamma-1b and Valganciclovir.	Virus infection [1A24-1D9Z]	[4]
-----------


⏷ Show the Full List of 43 DDI Information of This Drug

References

1	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
3	Genetic polymorphisms in the promoter of the interferon gamma receptor 1 gene are associated with atopic cataracts. Invest Ophthalmol Vis Sci. 2007 Feb;48(2):583-9.
4	Cerner Multum, Inc. "Australian Product Information.".
5	Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
6	Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
7	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
8	Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
9	Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
10	Product Information. Adcetris (brentuximab vedotin). Seattle Genetics Inc, Bothell, WA.
11	Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943]
12	Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
13	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
14	Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
15	Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
16	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
17	Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
18	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
19	Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
20	Product Information. Avonex (interferon beta-1a). Biogen, Cambridge, MA.
21	Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
22	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
23	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
24	Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
25	Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA.
26	Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
27	Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
28	Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
29	Krahenbuhl S, Sauter B, Kupferschmidt H, Krause M, Wyss PA, Meier PJ "Case report: reversible QT prolongation with torsades de pointes in a patient with pimozide intoxication." Am J Med Sci 309 (1995): 315-6. [PMID: 7771501]
30	Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE.