| DTT Name |
HUMAN vascular endothelial growth factor (VEGF)
|
| Synonyms |
Vascular endothelial cell growth factor |
| Gene Name |
VEGF
|
| BioChemical Class |
Growth factor
|
| UniProt ID |
VEGFA_HUMAN
; VEGFB_HUMAN
; VEGFC_HUMAN
; VEGFD_HUMAN
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
|
| Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
|
| KEGG Pathway |
- EGFR tyrosine kinase inhibitor resistance (hsa01521 )
- MAPK signaling pathway (hsa04010 )
- Ras signaling pathway (hsa04014 )
- Rap1 signaling pathway (hsa04015 )
- Calcium signaling pathway (hsa04020 )
- HIF-1 signaling pathway (hsa04066 )
- PI3K-Akt signaling pathway (hsa04151 )
- VEGF signaling pathway (hsa04370 )
- Focal adhesion (hsa04510 )
- Relaxin signaling pathway (hsa04926 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Human cytomegalovirus infection (hsa05163 )
- Human papillomavirus infection (hsa05165 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Pathways in cancer (hsa05200 )
- Proteoglycans in cancer (hsa05205 )
- MicroRNAs in cancer (hsa05206 )
- Chemical carcinogenesis - receptor activation (hsa05207 )
- Chemical carcinogenesis - reactive oxygen species (hsa05208 )
- Renal cell carcinoma (hsa05211 )
- Pancreatic cancer (hsa05212 )
- Bladder cancer (hsa05219 )
- Rheumatoid arthritis (hsa05323 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
| Reactome Pathway |
- Regulation of gene expression by Hypoxia-inducible Factor (R-HSA-1234158 )
- Signaling by VEGF (R-HSA-194138 )
- VEGF ligand-receptor interactions (R-HSA-194313 )
- VEGF binds to VEGFR leading to receptor dimerization (R-HSA-195399 )
- VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
- VEGFR2 mediated cell proliferation (R-HSA-5218921 )
- Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
- TFAP2 (AP-2) family regulates transcription of growth factors and their receptors (R-HSA-8866910 )
- Potential therapeutics for SARS (R-HSA-9679191 )
- Platelet degranulation (R-HSA-114608 )
|
|
|
|
|
|
|
