Details of the Drug

General Information of Drug (ID: DMSD1UN)

Drug Name
Bevacizumab
Synonyms Bevacizumab (ophthalmic slow-release tissue tablet)
Indication
Disease Entry ICD 11 Status REF
Adenocarcinoma 2D40 Approved [1]
Adult acute monocytic leukemia N.A. Approved [2]
Biliary tract cancer 2C17 Approved [3]
Childhood acute megakaryoblastic leukemia N.A. Approved [2]
Cholangiocarcinoma 2C12.10 Approved [4]
Colon adenocarcinoma N.A. Approved [5]
Colorectal carcinoma N.A. Approved [6]
Esophageal disorder N.A. Approved [7]
Glioblastoma 2A00 Approved [8]
Glioblastoma of brain 2A00.00 Approved [9]
Hemangioblastoma N.A. Approved [10]
Intracranial meningioma N.A. Approved [11]
Lung adenocarcinoma N.A. Approved [12]
Malignant epithelial tumor of ovary N.A. Approved [13]
Metastatic colorectal cancer 2B91 Approved [14]
Non-small-cell lung cancer 2C25.Y Approved [15]
Rectal adenocarcinoma 2B92 Approved [16]
Von hippel-lindau disease 5A75 Approved [17]
Colorectal cancer 2B91.Z Phase 3 [18]
Coronavirus Disease 2019 (COVID-19) 1D6Y Phase 2/3 [19]
Brain metastases 2D50 Phase 2 [18]
Lung cancer 2C25.0 Phase 1 [18]
Solid tumour/cancer 2A00-2F9Z Phase 1 [20]
Ovarian cancer 2C73 Application submitted [20]
Adult glioblastoma N.A. Investigative [21]
Colon cancer 2B90.Z Investigative [22]
Fallopian tube cancer 2C74 Investigative [23]
Hereditary hemorrhagic telangiectasia LA90.00 Investigative [24]
Lung large cell carcinoma N.A. Investigative [25]
⏷ Show the Full List of Indication(s)
Drug Type
Monoclonal antibody
Sequence
>light chain
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>heavy chain
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Adverse Drug Reaction (ADR)
ADR Term Variation Related DOT DOT ID REF
Hypertension rs6453204 SV2C OTIH108W [26]
Hypertension rs479825 MAML2 OT1TSVAR [26]
Hypertension rs3773651 TGFBR2 OT3P7GZP [26]
Hypertension rs1962073 MSRA OTBS15SD [26]
Hypertension rs130318 PARVB OT9OGVWX [26]
Hypertension rs11257188 PFKFB3 OT25JBA3 [26]
⏷ Show the Full List of 6 ADR Information of This Drug
Cross-matching ID
DrugBank ID
DB00112
TTD ID
D04KBL
Combinatorial Drugs (CBD) Click to Jump to the Detailed CBD Information of This Drug
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Vascular endothelial growth factor A (VEGFA) TTOHSBA VEGFA_HUMAN Inhibitor [27]
HUMAN vascular endothelial growth factor (VEGF) TT140V6 VEGFA_HUMAN ; VEGFB_HUMAN ; VEGFC_HUMAN ; VEGFD_HUMAN Inhibitor [19]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3) OT25JBA3 F263_HUMAN Drug Response [26]
Beta-parvin (PARVB) OT9OGVWX PARVB_HUMAN Drug Response [26]
Mastermind-like protein 2 (MAML2) OT1TSVAR MAML2_HUMAN Drug Response [26]
Mitochondrial peptide methionine sulfoxide reductase (MSRA) OTBS15SD MSRA_HUMAN Drug Response [26]
Synaptic vesicle glycoprotein 2C (SV2C) OTIH108W SV2C_HUMAN Drug Response [26]
TGF-beta receptor type-2 (TGFBR2) OT3P7GZP TGFR2_HUMAN Drug Response [26]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Adenocarcinoma
ICD Disease Classification 2D40
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Vascular endothelial growth factor A (VEGFA) DTT VEGFA 3.61E-01 0.15 0.47
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Bevacizumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Thalidomide DM70BU5 Major Additive thrombogenic effects by the combination of Bevacizumab and Thalidomide. Multiple myeloma [2A83] [28]

References

1 Bevacizumab in metastatic small-bowel adenocarcinoma: A systematic review and meta-analysis. Rare Tumors. 2019 May 14;11:2036361318825413.
2 A standard database for drug repositioning. Sci Data. 2017 Mar 14;4:170029.
3 Angiogenesis in biliary tract cancer: targeting and therapeutic potential. Expert Opin Investig Drugs. 2021 Apr;30(4):411-418.
4 Hepatobiliary Cancers, Version 2.2021, NCCN Clinical Practice Guidelines in Oncology. J Natl Compr Canc Netw. 2021 May 1;19(5):541-565.
5 Long-term response to sintilimab, bevacizumab and chemotherapy in heavily pretreated microsatellite stable colon cancer. Immunotherapy. 2023 Feb;15(3):127-133.
6 Ramucirumab versus placebo in combination with second-line FOLFIRI in patients with metastatic colorectal carcinoma that progressed during or after first-line therapy with bevacizumab, oxaliplatin, and a fluoropyrimidine (RAISE): a randomised, double-blind, multicentre, phase 3 study. Lancet Oncol. 2015 May;16(5):499-508.
7 Advances in targeted therapy for esophageal cancer. Signal Transduct Target Ther. 2020 Oct 7;5(1):229.
8 Bevacizumab alone and in combination with irinotecan in recurrent glioblastoma. J Clin Oncol. 2009 Oct 1;27(28):4733-40.
9 Synchronous glioblastoma and brain metastases: illustrative case. J Neurosurg Case Lessons. 2022 Mar 21;3(12):CASE21714.
10 Intra-arterial Bevacizumab for Posterior Fossa Hemangioblastoma. Cureus. 2022 Dec 17;14(12):e32624.
11 The controversial role of Bevacizumab in the treatment of patients with intracranial meningioma: a comprehensive literature review. Expert Rev Anticancer Ther. 2020 Mar;20(3):197-203.
12 International association for the study of lung cancer/american thoracic society/european respiratory society international multidisciplinary classification of lung adenocarcinoma. J Thorac Oncol. 2011 Feb;6(2):244-85.
13 Gynecologic cancer in pregnancy. Gynecol Oncol. 2020 Jun;157(3):799-809.
14 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
15 Paclitaxel-carboplatin alone or with bevacizumab for non-small-cell lung cancer. N Engl J Med. 2006 Dec 14;355(24):2542-50.
16 Phase II randomized trial of capecitabine with bevacizumab and external beam radiation therapy as?preoperative treatment for patients with resectable locally advanced rectal adenocarcinoma: long term?results. BMC Cancer. 2020 Nov 27;20(1):1164.
17 89Zr-Bevacizumab PET Visualizes Disease Manifestations in Patients with von Hippel-Lindau Disease. J Nucl Med. 2016 Aug;57(8):1244-50.
18 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
19 ClinicalTrials.gov (NCT04275414) Bevacizumab in Severe or Critical Patients With COVID-19 Pneumonia (BEST-CP)
20 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
21 Lomustine and Bevacizumab in Progressive Glioblastoma. N Engl J Med. 2017 Nov 16;377(20):1954-1963.
22 Colon cancer. Crit Rev Oncol Hematol. 2010 May;74(2):106-33.
23 OCEANS: a randomized, double-blind, placebo-controlled phase III trial of chemotherapy with or without bevacizumab in patients with platinum-sensitive recurrent epithelial ovarian, primary peritoneal, or fallopian tube cancer. J Clin Oncol. 2012 Jun 10;30(17):2039-45.
24 Hereditary hemorrhagic telangiectasia: diagnosis and management from the hematologist's perspective. Haematologica. 2018 Sep;103(9):1433-1443.
25 Non-small cell lung cancer: epidemiology, risk factors, treatment, and survivorship. Mayo Clin Proc. 2008 May;83(5):584-94.
26 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100. Br J Cancer. 2014 Sep 9;111(6):1241-8. doi: 10.1038/bjc.2014.430. Epub 2014 Aug 12.
27 FDA Approved Drug Products from FDA Official Website. 2004. Application Number: (ANDA) 125085.
28 Bennett CL, Nebeker JR, Samore MH, et al "The Research on Adverse Drug Events and Reports (RADAR) project." JAMA 293 (2005): 2131-40. [PMID: 15870417]