Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1QUZV)
| DTT Name | Methionine-R-sulfoxide reductase B1 (MSRB1) | ||||
|---|---|---|---|---|---|
| Synonyms | Selenoprotein X; SelX; SEPX1; MsrB1 | ||||
| Gene Name | MSRB1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
MsrB Met sulfoxide reductase family
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| EC Number |
EC 1.8.4.12
|
||||
| Sequence |
MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPE
HNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH |
||||
| Function |
Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by MICALs (MICAL1, MICAL2 or MICAL3) on actin, thereby promoting filament repolymerization. Plays a role in innate immunity by reducing oxidized actin, leading to actin repolymerization in macrophages.
|
||||
| Reactome Pathway | |||||
The Drug-Metabolizing Enzyme (DME) Role of This DTT
| DTT DME Name | Methionine-R-sulfoxide reductase B1 (MSRB1) | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Name | MSRB1 | |||||||||||||||||||||||||||
|
1 Investigative Drug(s) Metabolized by This DTT
|
||||||||||||||||||||||||||||
References