Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEFADPU)

DME Name Methionine-R-sulfoxide reductase B1 (MSRB1)
Synonyms Selenoprotein X; Methionine-sulfoxide reductase B1; Reductase methionine-sulfoxide B1; HSPC270; MSRB1; MsrB1; SEPX1; SelX
Gene Name MSRB1
UniProt ID
MSRB1_HUMAN
INTEDE ID
DME0184
Gene ID
51734
EC Number EC: 1.8.4.12
Oxidoreductase
Sulfur donor oxidoreductase
Disulfide acceptor oxidoreductase
EC: 1.8.4.12
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPE
HNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH
Function This enzyme specifically reduces methionine (R)-sulfoxide back to methionine.
Reactome Pathway
Protein repair (R-HSA-5676934 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-methionine DME8G1U Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.36E-62 -2.23E+00 -2.60E+00
Alopecia ED70 Skin from scalp 1.45E-02 1.91E-01 4.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.33E-02 5.98E-02 2.58E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.55E-01 2.42E-01 3.35E-01
Aortic stenosis BB70 Calcified aortic valve 4.37E-01 1.14E-01 3.28E-01
Apnea 7A40 Hyperplastic tonsil 9.45E-01 7.85E-02 1.66E-01
Arthropathy FA00-FA5Z Peripheral blood 9.10E-02 1.75E-01 5.38E-01
Asthma CA23 Nasal and bronchial airway 3.38E-05 1.66E-01 1.35E-01
Atopic dermatitis EA80 Skin 1.90E-01 1.69E-01 3.43E-01
Autism 6A02 Whole blood 7.02E-01 9.00E-03 2.11E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.02E-01 1.44E-01 3.32E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.28E-01 -1.03E+00 -1.21E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.93E-10 3.32E-01 1.02E+00
Batten disease 5C56.1 Whole blood 6.32E-01 8.64E-03 2.61E-02
Behcet's disease 4A62 Peripheral blood 4.59E-01 8.32E-02 2.49E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.78E-01 -6.67E-03 -3.26E-02
Bladder cancer 2C94 Bladder tissue 1.15E-02 5.12E-01 1.43E+00
Breast cancer 2C60-2C6Z Breast tissue 1.25E-48 3.98E-01 1.29E+00
Cardioembolic stroke 8B11.20 Whole blood 5.15E-05 3.01E-01 1.07E+00
Cervical cancer 2C77 Cervical tissue 4.56E-03 3.85E-01 8.36E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.03E-01 3.07E-01 1.75E-01
Chronic hepatitis C 1E51.1 Whole blood 5.89E-01 -1.33E-01 -2.46E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.91E-01 -7.99E-02 -1.86E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.34E-07 5.07E-01 1.20E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.29E-01 2.72E-01 1.55E+00
Colon cancer 2B90 Colon tissue 5.60E-11 1.97E-01 6.06E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.27E-01 3.32E-01 3.31E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.23E-02 -7.56E-01 -1.40E+00
Endometriosis GA10 Endometrium tissue 5.36E-02 2.34E-01 5.98E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.28E-02 -2.66E-01 -5.97E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.92E-09 -7.39E-01 -1.42E+00
Gastric cancer 2B72 Gastric tissue 3.24E-01 1.79E-01 3.37E-01
Glioblastopma 2A00.00 Nervous tissue 2.09E-56 5.06E-01 1.30E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.28E-01 -2.62E-01 -3.15E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.54E-01 3.25E-01 2.79E-01
Head and neck cancer 2D42 Head and neck tissue 8.84E-13 5.07E-01 8.45E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.01E-01 1.07E-02 3.63E-02
Huntington's disease 8A01.10 Whole blood 7.19E-01 -1.80E-01 -1.88E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.62E-02 -6.76E-01 -1.52E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.26E-02 1.11E-01 1.13E+00
Influenza 1E30 Whole blood 5.31E-01 6.85E-02 1.50E-01
Interstitial cystitis GC00.3 Bladder tissue 2.87E-03 5.46E-01 2.40E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.22E-04 -6.50E-01 -1.24E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.39E-03 -3.69E-01 -5.53E-01
Ischemic stroke 8B11 Peripheral blood 2.78E-01 -7.76E-02 -1.63E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.80E-01 1.62E-02 1.13E-02
Lateral sclerosis 8B60.4 Skin 1.89E-01 1.77E-01 9.01E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.22E-01 -1.42E-01 -3.11E-01
Liver cancer 2C12.0 Liver tissue 2.54E-10 -3.04E-01 -9.46E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.78E-04 -1.56E+00 -3.20E+00
Lung cancer 2C25 Lung tissue 3.10E-14 2.25E-01 7.45E-01
Lupus erythematosus 4A40 Whole blood 8.37E-03 2.53E-01 1.73E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.91E-01 -1.25E-03 -6.15E-03
Major depressive disorder 6A70-6A7Z Whole blood 6.67E-01 -3.42E-02 -6.56E-02
Melanoma 2C30 Skin 1.15E-02 -2.92E-01 -2.92E-01
Multiple myeloma 2A83.1 Peripheral blood 7.32E-01 -8.12E-02 -1.45E-01
Multiple myeloma 2A83.1 Bone marrow 4.70E-01 -7.77E-02 -3.49E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.64E-01 -5.23E-01 -8.57E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.58E-08 4.55E-01 1.31E+00
Myelofibrosis 2A20.2 Whole blood 3.37E-01 2.99E-01 9.65E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.00E-02 1.13E+00 5.44E-01
Myopathy 8C70.6 Muscle tissue 5.01E-03 6.02E-01 1.53E+00
Neonatal sepsis KA60 Whole blood 1.12E-06 8.44E-01 7.95E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.64E-01 -6.41E-02 -1.60E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.86E-01 -8.45E-02 -3.08E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.82E-01 1.22E-01 3.36E-01
Olive pollen allergy CA08.00 Peripheral blood 3.83E-01 5.51E-01 7.01E-01
Oral cancer 2B6E Oral tissue 3.19E-03 5.01E-01 7.86E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.71E-01 3.20E-01 3.21E-01
Osteoporosis FB83.1 Bone marrow 4.09E-02 -2.88E-01 -1.05E+00
Ovarian cancer 2C73 Ovarian tissue 1.61E-02 5.57E-01 1.17E+00
Pancreatic cancer 2C10 Pancreas 4.60E-02 -7.33E-01 -6.91E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.30E-01 7.82E-02 5.08E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.04E-07 1.38E+00 2.56E+00
Pituitary cancer 2D12 Pituitary tissue 1.79E-01 -4.41E-01 -5.55E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.05E-02 -6.50E-01 -8.91E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.54E-01 -2.22E-01 -8.62E-01
Polycythemia vera 2A20.4 Whole blood 2.69E-09 3.97E-01 1.30E+00
Pompe disease 5C51.3 Biceps muscle 2.14E-06 1.19E+00 3.95E+00
Preterm birth KA21.4Z Myometrium 4.19E-02 6.50E-01 2.12E+00
Prostate cancer 2C82 Prostate 8.76E-06 -6.77E-01 -1.06E+00
Psoriasis EA90 Skin 6.65E-01 -6.32E-02 -1.13E-01
Rectal cancer 2B92 Rectal colon tissue 2.01E-03 -3.09E-01 -2.24E+00
Renal cancer 2C90-2C91 Kidney 1.16E-03 -8.43E-01 -1.45E+00
Retinoblastoma 2D02.2 Uvea 1.36E-09 1.33E+00 3.91E+00
Rheumatoid arthritis FA20 Synovial tissue 4.84E-03 6.86E-01 1.41E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.23E-03 4.22E-02 2.29E-01
Schizophrenia 6A20 Prefrontal cortex 6.54E-02 1.75E-01 1.40E-01
Schizophrenia 6A20 Superior temporal cortex 4.84E-01 2.28E-02 1.14E-01
Scleroderma 4A42.Z Whole blood 2.12E-04 3.94E-01 2.35E+00
Seizure 8A60-8A6Z Whole blood 1.73E-01 5.40E-01 7.11E-01
Sensitive skin EK0Z Skin 5.26E-01 -1.09E-01 -2.73E-01
Sepsis with septic shock 1G41 Whole blood 7.31E-54 1.29E+00 1.96E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.60E-01 8.13E-01 1.23E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.59E-01 -1.95E-01 -7.31E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.32E-01 -1.89E-01 -5.29E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.23E-01 -3.76E-01 -1.01E+00
Skin cancer 2C30-2C3Z Skin 7.35E-31 -6.79E-01 -1.02E+00
Thrombocythemia 3B63 Whole blood 2.47E-03 1.80E-01 5.80E-01
Thrombocytopenia 3B64 Whole blood 1.62E-01 4.79E-01 3.99E-01
Thyroid cancer 2D10 Thyroid 3.69E-01 2.49E-02 1.12E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.52E-06 6.88E-01 1.75E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.05E-02 5.43E-01 2.04E+00
Type 2 diabetes 5A11 Liver tissue 5.38E-01 1.89E-02 7.05E-02
Ureter cancer 2C92 Urothelium 2.77E-01 -2.36E-03 -3.57E-03
Uterine cancer 2C78 Endometrium tissue 7.42E-01 1.40E-02 1.65E-02
Vitiligo ED63.0 Skin 7.89E-01 -1.01E-02 -1.94E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Methionine-R-sulfoxide reductase B1 (MSRB1) DTT Info
DME DTT Type Literature-reported

References

1 Catalytic advantages provided by selenocysteine in methionine-S-sulfoxide reductases. Biochemistry. 2006 Nov 21;45(46):13697-704.