Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1UCIJ)

DTT Name	C-X-C chemokine receptor type 3 (CXCR3)
Synonyms	Interferon-inducible protein 10 receptor; IP-10 receptor; GPR9; G protein-coupled receptor 9; Chemokine receptor CXCR3/interferon-inducible protein-10; Chemokine receptor CXCR3; CXCR3/IP-10; CXCR-3; CXC-R3; CKR-L2; CD183 antigen; CD183
Gene Name	CXCR3
DTT Type	Preclinical target	[1]
BioChemical Class	GPCR rhodopsin
UniProt ID	CXCR3_HUMAN
TTD ID	T25315
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET SEASYSGL
Function	Binds to CCL21. Probably promotes cell chemotaxis response. Isoform 1: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Chemokine signaling pathway (hsa04062 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
T487	DMZTL7H	Psoriatic disorder	EA90	Discontinued in Phase 2	[1]
------------------------------------------------------------------------------------

2 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
dioscin	DM5H2W9	Hepatic fibrosis	DB93.0	Preclinical	[2]
JT07	DMHBWOP	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3]
------------------------------------------------------------------------------------

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
hypoglaucin A	DMJKIUX	Discovery agent	N.A.	Investigative	[2]
kallstroemin D	DM7YAE0	Discovery agent	N.A.	Investigative	[2]
NBI-74330	DMURC6X	Discovery agent	N.A.	Investigative	[1]
Sch-900875	DM346KA	Inflammation	1A00-CA43.1	Investigative	[4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	1.68E-01	-0.24	-0.52
------------------------------------------------------------------------------------

References

1	Pharmacological characterization of CXC chemokine receptor 3 ligands and a small molecule antagonist. J Pharmacol Exp Ther. 2005 Jun;313(3):1263-71.
2	Discovery of structurally diverse natural product antagonists of chemokine receptor CXCR3. Mol Divers. 2005;9(1-3):123-9.
3	Clinical pipeline report, company report or official report of Jyant Technologies.
4	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 70).